CAZyme Information: ASPBRDRAFT_176109-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_176109-t33_1-p1
• CAZy Family: GH12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1492	KV878683|CGC13	167321.54	4.6894

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878683:1193273-1197976(+)

Full Sequence      

MLPGLGNVASWRLASLLVAGLLAIQGRASPSVNVALQASFDSPPYLIELLESAAEENSTS
YFPLLDRIADGTFDDAVTDKDLYDRFLEVVREDGHLRTPESLSSFKLSLAMRSASPRITA
HYQFYNASVQHSLMAAQDAVCPVWVHSEGKQYCSSTMERAQQDVTGSDDPRELPFDRVFG
DPSLPSAILYADIASPMFKEFHQSLSILAKEGQFSYRVRYRPPQHSTPRPVFVSGYGVEL
ALKRTDYIVIDDRDAEERGTGSIESGKSDETEDDLDDLRPLSSSEVSRLGLNTVGYVLDS
DDPFDTLVKLSQDFPKYSARVAGHNVSTELLQDIRSSRLRMLPPGLNVLWINGVQIEPRQ
VDAFTLLDHLRRERKLIEKFRNLGLSATEAVDLLSHPLLGEALAQDGPQRYNYRDDIEGG
GVIMWLNDLEKDARYESWPSELAGFMQRTYPGQLPAVRRDSNNIVFPVDLTSTEDAEIVV
KTIQVFVKNKIPVRFGLIPVTFSDGAVAQLKVAHYLQETFGLASFMDYLEASTLKNKLAS
PDKACFQAATQDRDPRPEKVSLTLDEVLNKDEFDATVSKTTAYLNRLGMKHEASHAFVNG
IPVTRNDKWAQEMSTRISRDTQLIQQKIADAEVDEDTWLPELFLSKAFDRRNPAIIPEDP
KEVRAVDLVKIADTHEVFSQIPRLALEGSNALESAHVIVVGNFDDESGYELLSAVLESRK
THGEVEMLFLHNPNLGASPASRSVAIRRLLNGGKEVDTSQILEAIASSAAPADEEAGDAA
QFWETQRAVVEELGLAPGERALIINGRVVGPIAEGTALASEDLDQLLIFEKQKRITPVAR
AAKVLGFGEKLSDALDFAKLTSLTTLSTISDVPEGIYESTLDIRMYLFNRWNDSKSAITV
SNSEDPAITIVASIDPTSEVAQKWLPILKVLSELASVRVRLVLNPREEIKELPTKRFYRY
VLDSEPSFNEDGSVSRPTASFSGVPVEALLTLGMDVPSSWLVAPKDSVHDLDNIKLSSVK
EGSNVDAIYALEHILIEGHSRDMTTKSPPRGVQLVLGTENNPHFSDTIIMANLGYFQFKA
QPGLWNINLKPGRSERIFTLDSVGSLGYNPQPGDETNEVALLSFQGRTLFPRVSRKKGYE
TEDVLESNPKPGSAMDYMNKGFNFASGILSSVGVGTKDSSKQADINIFSVASGHLYERML
NIMMVSVMRNTNHSVKFWFIEQFLSPSFKSFLPHLAKEYNFSYEMVTYKWPHWLRAQKEK
QREIWGYKILFLDVLFPLDLDKVIFVDADQIVRTDMYDLVSLDLEGAPYGFTPMCDSRHE
MEGFRFWKQGYWKNFLRGQPYHISALYVVDLNRFRAIAAGDRLRGQYQMLSADPESLSNL
DQDLPNHMQHHLPIKSLPQEWLWCETWCSDESQSQARTIDLCNNPMTKEPKLDRARRQVP
EWTEYDDEIAALSKRVSEKQQQQQAEEERDGELYSEDDEEGEASSGWDKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1185	1432	2e-135	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1185	1432	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1185	1452	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	1.10e-92	411	655	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	3.55e-65	1037	1146	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
408199	Thioredoxin_12	6.62e-65	42	226	1	182	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39488.1|GT24	0.0	1	1492	1	1495
CAS97678.1|GT24	0.0	1	1492	1	1495
BCR94558.1|GT24	0.0	1	1492	1	1495
BCS07152.1|GT24	0.0	1	1492	1	1495
BAE65008.1|GT24|2.4.1.-	0.0	1	1492	1	1487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	25	1459	4	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	25	1459	4	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5Y7O_A	0.0	31	1152	5	1130	Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii],5Y7O_B Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii]
6TRT_A	0.0	25	1459	4	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	25	1459	4	1220	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	2.72e-297	18	1457	9	1429	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9JLA3|UGGG1_RAT	8.46e-252	29	1452	44	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.85e-251	29	1461	44	1532	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	3.28e-251	29	1452	44	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q09332|UGGG_DROME	6.93e-238	26	1458	22	1513	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999700	CS pos: 28-29. Pr: 0.9558

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_176109-t33_1-p1.