CAZyme Information: ASPBRDRAFT_167240-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_167240-t33_1-p1
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553	KV878679|CGC18	60138.78	5.2072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878679:3203688-3205349(-)

Full Sequence      

MSEPYDYIIVGGGLTGCALAGRLSEKDESLRVLIIEAGPNVVDHPLTSTPLACFAAHHSP
LDWDYTTVPQKHLNDRECYNAAGKALGGGTAINYGTWTRGNAADYNLWATIVGDSSWSYD
GLLPYFKRVETHYDPNADPAIHGTSGPITNTIVALTSPDRKYPLKEPVRSAWERIGVKFN
PDANAGSALGLAHFGENWRDGQRQLASEAYGLSKHQGISILTETLVEKVTLDEQDGQQVA
TGVKVVGGQEYHATREVIISAGTYRTPQVLMLSGIGPADELAKHNIPLRVDSPDVGRNFH
DHMCFPQWWKLRHPERGLSMGTPLWDSPAYGMGVPYDWNVTLQTPADDLVRAIQADDGCT
PNKDHPFLDPQFAHSEILVIYAPMTRAVTGFETPMDGTHISTAVLLMTPTARGQITIADA
NPTSAPVIDPNYCSKEVDRAILRDGIRRVAKLLLDTPEGQDIVDTEVPRPGNEPIRLDST
DEEIDRNISNGAITFFHPGGSASMGKVVDTQLRVKGVKGLRVADASVLPVPLVAHYQAIL
YAMAEKAADLLLS

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_167240-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	552	8.6e-152	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.09e-96	1	553	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.45e-94	1	552	2	532	choline dehydrogenase; Validated
274888	Rv0697	2.42e-55	6	552	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	4.25e-37	74	304	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	8.57e-37	409	547	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40717.1|AA3_2	0.0	1	552	1	552
BCS16263.1|AA3_2	0.0	1	553	1	553
BCS04695.1|AA3_2	0.0	1	553	1	553
BCS24407.1|AA3_2	2.13e-248	5	551	4	559
EAA58856.1|AA3_2	2.72e-247	1	553	1	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	2.18e-70	5	551	7	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.05e-70	5	551	7	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	4.26e-70	5	551	7	569	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	2.01e-63	5	551	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.08e-62	5	551	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	2.95e-150	1	553	1	520	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|A0A3B1EFP9|STR4_STRTC	1.33e-68	2	551	33	611	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	3.20e-65	2	553	4	535	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|P0DO29|ERIK_HERER	2.03e-63	2	551	31	595	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|P64264|Y1310_MYCBO	1.82e-61	1	553	1	528	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997610	0.002414

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_167240-t33_1-p1.