CAZyme Information: ASPBRDRAFT_164608-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_164608-t33_1-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
915		104113.00	5.4409

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878705:47333-50080(+)

Full Sequence      

MQITRCGIHGFHEVLGIDVDEIRFYWTIETDDKDASQLAYQIVLSTDETAVQGDAIDESN
LAWDSGRVMSNEQRNIICKPDNGFQSTCSYYWRATVWDQLQRPHHSAVNHFFTAYPRSHL
LPPYSMNQTYMPHTSLIFRSWFEDEPNRWKAVWIGDGGDKPIYLRKAFDLAEAPTRAILF
ASGLGHFNMNVNGTPASDHRLDPGWTNYHRRVQFTAYDVTAQLKTGANVLGAHVGNGFYA
GDKGDDRFFWPMYEDNTYVRYGNELCFFSELHLFYRDGSHTTMISDPSWRVRKSATTLAN
IYASENHDRREYPTGWDTPDFDDADWAPAKPLTGPRGHIYYQTQPPVVLHETFEPVKITE
PRPGMVCYDLGQNASTMVRIEVEGPRGAEIIVRYSETIREDGTVLMPDPLFKEFETGVFS
RIHLAGTGAPETWEPDFSFTSARYIQVEGVSLDGSDGRPVIRSVVGRHISSAARRLGTMQ
TDKEDVNQLLSALSWTFSSNLFSYHTDCPQIEKFGWLEVTHLLAPATQYVRDMEALYTKI
LDDILDAQEPSGLVPTMAPEIRYMCGPLHDTITWGCAVCLLPDILREYYGSTHVVAKVFP
AAVRYMEYMRTKERRGGLIEHGLGDWGRGIAFGNNQANIETAIYYRCLQCVAMMARELGE
TQKAEEFEQWAARIYIVYNRHLLVTDDTSRPYAYYTSLDNYPERDRDAIAQAMALQFGLV
PEQYRKDVMAAFLDDVADGRMRAGEIGLRFLFNTLADAKRPDLVLQMARQEEHPSYMRFL
RRGETTLLEFWQDECRSKCHDMLGTIHEWFYAAVLGLKPTGPAYRTFVVDPPYDAEFEHV
KGSVDCPYGKIGIEFTRNEQGQATVNVRVPFGTTATVKLPRSGKSSAYCRQGEESRDVNG
GEVSLSHGAYSIFVR

Enzyme Prediction     

EC	3.2.1.40:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	358	879	2.8e-128	0.998015873015873
CBM67	160	333	2.3e-33	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	5.10e-97	474	814	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	8.83e-69	173	351	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	1.11e-20	359	470	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	1.03e-18	816	885	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07621.1|GH78	0.0	1	915	1	915
BCR95051.1|GH78	0.0	1	915	1	915
CAK39248.1|GH78	0.0	1	912	1	912
CAP83097.1|GH78	0.0	1	915	1	916
EGX44008.1|GH78	0.0	1	912	10	922

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.89e-94	15	914	44	941	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	4.41e-79	164	880	305	995	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.85e-59	1	883	2	850	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	1.95e-78	164	880	305	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KPL4|PLH28_FORAG	7.47e-71	15	912	44	947	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
sp|T2KNB2|PLH20_FORAG	1.16e-61	10	886	43	885	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|P9WF03|RHA78_ALTSL	2.72e-61	10	880	39	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_164608-t33_1-p1.