CAZyme Information: ASPBRDRAFT_155203-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_155203-t33_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429		45962.79	4.3138

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878686:386929-388456(+)

Full Sequence      

MAFIAFKTLLLASLIIPSLSLSDQARNGNARTLCEVKPGGSSEIDDVPAIIDALTTCGSG
GRVTFTNHTYYINSVMNTTWLDDVEIDLQGTLLWSTNISYWLNHSLPVGYQNQSTAWILG
GKDIIFEGHGYGTFNGSGQTWYKYVGSKSNYPRRPNQLTVSGATGAVFKGLRFVQSQMWT
MSIIYTSDSWFDSIYVNNLYDDGDSAQNTDGANTIYSNNITFTNWEVINGDDSISTKANS
TDITIADSTFTSGLGIAIGSIGQYNGAFETVERLRISNITYDKTTHAVYFKTWTGDQVGY
PPNGGGGGLGYASDIVATKLKTNNLKGAPFTISQCTTFSGASGNCTNSKFQIRDLVFTDI
SGTTDSSDVASFQCSAVAPCEDITIENVSLRIAGNTTYADEYLCGNVDGTTGFNCTGDVC
VGSSATGGC

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_155203-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	61	409	2.5e-57	0.9476923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177865	PLN02218	1.06e-21	12	391	60	409	polygalacturonase ADPG
395231	Glyco_hydro_28	3.05e-20	82	390	24	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215120	PLN02188	4.01e-19	9	391	7	375	polygalacturonase/glycoside hydrolase family protein
178580	PLN03003	1.34e-16	130	424	119	392	Probable polygalacturonase At3g15720
215540	PLN03010	1.88e-16	27	426	43	408	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38178.1|GH28	8.08e-297	1	429	35	463
ABD61567.1|GH28	8.08e-297	1	429	35	463
BCS12167.1|GH28	1.08e-249	76	429	1	354
BCS00389.1|GH28	1.08e-249	76	429	1	354
QRD90865.1|GH28	2.01e-172	30	429	19	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	3.91e-33	29	416	14	383	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	1.23e-06	82	397	41	338	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QG68|RGXB_ASPNC	3.98e-298	1	429	1	429	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2
sp|Q2EQQ2|RGXA_ASPNG	4.15e-71	6	408	12	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	6.35e-70	11	408	12	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|Q2UP32|RGXA_ASPOR	7.88e-67	34	415	31	435	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|B8NJB0|RGXA_ASPFN	7.88e-67	34	415	31	435	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999736	CS pos: 22-23. Pr: 0.8018

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_155203-t33_1-p1.