CAZyme Information: ASPBRDRAFT_134466-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_134466-t33_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		55570.58	5.0733

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878692:114907-116678(+)

Full Sequence      

MVKLISLLGAVAAFAASGTAADVSPSPSGTAPKSSSAADSLSSLGLSLPAGKVPVGDVGY
TCNVLSRAFPKNETFTASSPYYEALIDETWSGNSRLNASCIVTPRSAQEVSLVIQILSTL
ETKFSIRSGGHSSNPGFSSIGSNGVLVALERLNTLSISADRKTVTVGPGNRWEAVYQYLE
PYNLTVLGGREPDVGVGGFILGAGGLSLFYNTNGLAIDTVTRFKMVTPNGTIVNATATEH
ADLYKGLKGGLNNFGIIVEYDLTTNTGIDVWFEVKNYTRAETPALLAAYANYLQNADVRS
NVEIQTNPAYTLAFYGYLDHVSAPSAFNDFSKVPSVSTLYPPTNASLNQVLVDIGSAGVI
GSSYTYSISFCFKVTSPSFLQATYKAYLETAASLLSMGVILEYVPQGIIPNLVTKSQTQN
GGNLLGLEATPQVWGEIFAQYPATVSQSTVSSAVNGLLSNLTSSAKSQGVHLPYIFANDA
GPDQQVLRGYGEDSVKYIAAVAKRYDPKGVMQTLQNDAYFVSKEM

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	90	325	1.3e-47	0.5109170305676856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	3.77e-25	98	236	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.96e-24	65	262	2	201	FAD/FMN-containing dehydrogenase [Energy production and conversion].
215258	PLN02465	4.58e-08	88	262	87	258	L-galactono-1,4-lactone dehydrogenase
178402	PLN02805	4.27e-07	101	262	137	302	D-lactate dehydrogenase [cytochrome]
215242	PLN02441	4.44e-06	90	257	57	231	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
RDX44700.1|AA7|1.1.3.-	4.99e-15	99	308	70	284
ADI58761.1|AA7|1.1.3.-	5.71e-14	99	307	38	251
AAS79317.1|AA7|1.1.3.-	1.46e-13	99	307	63	276
CEI70304.1|AA7	2.52e-13	53	264	9	226
AEO62186.1|AA7	5.92e-13	101	264	62	225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HSU_A	2.18e-15	99	307	44	257	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
6FYD_A	2.52e-15	61	296	10	240	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYF_A	4.47e-15	61	296	10	240	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
6FYG_A	4.47e-15	61	296	10	240	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]
1ZR6_A	5.10e-15	99	307	44	257	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G3Y424|YANF_ASPNA	1.12e-304	1	525	71	580	FAD-dependent monooxygenase yanF OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) OX=380704 GN=yanF PE=1 SV=1
sp|A0A2P1DP98|MACF_PENTR	2.21e-242	1	525	1	519	FAD-dependent monooxygenase macF OS=Penicillium terrestre OX=374132 GN=macF PE=3 SV=1
sp|A0A0U5GQ05|DRTC_ASPCI	3.51e-57	51	523	34	515	FAD-dependent monooxygenase drtC OS=Aspergillus calidoustus OX=454130 GN=drtC PE=1 SV=1
sp|D7UQ40|SOL5_ALTSO	1.01e-46	56	514	53	507	Bifunctional solanapyrone synthase OS=Alternaria solani OX=48100 GN=sol5 PE=1 SV=1
sp|B6H064|PRX3_PENRW	4.85e-46	62	514	32	500	FAD-dependent monooxygenase prx3 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=prx3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000312	0.999672	CS pos: 20-21. Pr: 0.9476

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_134466-t33_1-p1.