CAZyme Information: ASPBRDRAFT_129481-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_129481-t33_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	KV878687|CGC11	47581.40	5.7667

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878687:191059-192327(-)

Full Sequence      

MPRRRLILVAALLALGLLYSLSSHGASSPPLQIIPDDCPSRPDLDNILVVLKTGVTESRT
KVPIHLSTTLRCIPNHVLFSDYVEQLSPTHFTHDVLASLSPALLDHNPELDLYRRVRADG
PAALTSADLNPDVNTPIGKPNNPGWKLDKWKFLPMLDEALRVKPDASWYIFLEADTYLVW
DNFLEWLRRFDPSRPWYLGNQMQIVDAVFAHGGSGFALSRPALVQAVNHRKRSSDGWEFA
VAEHWAGDCMLGILLENVGVELTWSWPMLQIAPPEEMDYFSVGYAKRPWCYPAVSFHHLD
EQGIRQLDDLERELGPRKTPLLYRDVFLKLVRPELRDVRTDWDNLVEGDPVRVSSFAACR
GVCTREAKCLQYAYNATEGACRTSTVLALGHARPGVSAGWMTERIDAMAESLGECREISW
ID

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_129481-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	1.85e-06	161	286	80	226	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAL00916.1|GT31	1.28e-313	1	422	1	422
BCS14707.1|GT31	3.53e-311	1	422	1	422
BCS03059.1|GT31	3.53e-311	1	422	1	422
QMW28702.1|GT31	9.24e-154	2	421	11	437
QRD83231.1|GT31	9.24e-154	2	421	11	437

PDB Hits     

ASPBRDRAFT_129481-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9JJ06|C1GLT_MOUSE	1.60e-09	126	350	122	363	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1
sp|Q9NS00|C1GLT_HUMAN	2.13e-09	165	350	161	363	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1
sp|Q9JJ05|C1GLT_RAT	6.72e-09	126	350	122	363	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1
sp|Q0VC84|C1GLT_BOVIN	1.62e-08	165	352	161	364	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
sp|Q5F3G7|C1GLT_CHICK	6.74e-08	126	316	123	329	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Gallus gallus OX=9031 GN=C1GALT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.224991	0.774982	CS pos: 25-26. Pr: 0.7403

TMHMM  Annotations     

Start	End
7	26