CAZyme Information: ASPBRDRAFT_121516-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_121516-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		43128.01	4.7944

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878682:2750030-2751190(-)

Full Sequence      

MYSLLGFLAALGCAQSALAAPLTSSSNSSYIDWRTFKGNGVNLGGWLVQESTIDTQFWAK
YSGGASDEWGLCEHLGTQCGPVLEHRYATWITKADIDKLASAGITVLRIPTTYAAWIDLP
SSQLYSGNQTAYLKEIADYAITTYNMHIVIDTHSLPGGVNGLTIGEATGHWDWFYNETNF
HYSLQVIDQVINFIQHSGSPQSYTLAPINEPADNNTNMVVFGTPLALTDHGAAWVLKYIR
AVIQHVSSVNPNIPVMFQGSFKYPQYWEGDFPATTNLVFDMHHYYYEHMDSSSENLPEYI
LADAREKSGTGKFPVFVGEWAIQATYNNTLALRKRNVLAGLETWRNFSQGSSYWTAKFTG
NATVDGQGEQKDYWSYETFIDEGYFN

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	87	367	6.6e-153	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.97e-07	90	321	24	237	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.06e-07	35	193	15	175	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR97554.1|GH5_23	2.81e-276	1	386	1	386
BCS10017.1|GH5_23	2.81e-276	1	386	1	386
CAK39791.1|GH5_23	8.05e-276	1	386	1	386
QHN63926.1|GH5_23	1.10e-273	1	386	1	386
BAE61018.1|GH5_23	3.89e-204	1	386	1	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1A_A	2.27e-263	20	386	4	370	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6LA0_A	1.17e-199	20	386	1	365	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6ZB9_A	8.99e-11	37	385	2	386	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	5.06e-10	37	385	2	386	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	7.07e-27	14	320	17	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q9URU6|EXG1_SCHPO	9.73e-25	27	321	28	314	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
sp|A1CRV0|EXGA_ASPCL	3.31e-21	40	320	44	308	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|A1D4Q5|EXGA_NEOFI	4.53e-21	40	321	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
sp|Q0CR35|EXGA_ASPTN	4.53e-21	14	320	16	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999768	CS pos: 19-20. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_121516-t33_1-p1.