CAZyme Information: ASPBRDRAFT_121320-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_121320-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	KV878682|CGC5	50741.12	4.6881

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878682:242886-244332(+)

Full Sequence      

MTINTESTASEERTPKPLIVIACASIIGHILPLLPHATELTKQGFDVSFICGSEFEMPIR
KTGATFYPLEKAYSREQVDYVNTISDLSARIIWSMKTFFIDVTASRMKSLQAVLELLREM
YPDREVILIQELCYMGTWPFLLGAPLPKGYAQFPKTLTFSTTPLLVSSVDTPPFMSGLPP
DSSDEGRARNAAMYAAEKPLYDELADYANSVYASLGATVKVHQRIFDLWSTGHNILLQPC
SPSLEYPRSDLSPKVRFIGGTPRREIDPSTPLPAWWGELETNKQATNPKKVVFVTQGTIR
TYYRELIIPAMQAFANRPDVMVISALGVNGAVLDDDFEVPDNAKVIDYLSYDAVLPYVDV
FVTNGGYGSFMHGVMNGVPMVLAGTVQDKGEVCMRGEWAGIGINLRTDTPSAETIRESVE
RILGDPKYKARSLVIQRENEELDCVGSLQRYMLEDE

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_121320-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	100	444	2.4e-32	0.7879581151832461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224732	YjiC	1.63e-39	19	445	5	388	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
340817	GT1_Gtf-like	1.94e-31	19	441	3	391	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
273616	MGT	2.70e-31	28	441	7	375	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	1.37e-08	244	429	237	412	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	4.92e-04	328	431	335	438	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39187.1|GT1	6.01e-279	1	456	1	456
BCS13313.1|GT1	1.25e-266	1	456	1	455
BCS01597.1|GT1	1.25e-266	1	456	1	455
UQC81531.1|GT1	3.02e-116	10	454	114	556
UPK94024.1|GT1	7.67e-116	16	453	25	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PNT_A	8.89e-13	283	442	264	415	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
6J31_A	1.75e-10	283	438	222	376	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	1.77e-10	283	438	225	379	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
4M83_A	3.30e-10	220	438	160	380	Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]
2IYF_A	3.30e-10	220	438	160	380	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	1.37e-100	18	453	19	455	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E7CQW6|UGTA1_STABO	1.13e-71	16	449	7	428	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|E9L011|UGTB1_STABO	2.70e-62	16	449	5	424	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	5.03e-51	19	445	5	410	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|Q53685|OLED_STRAT	1.77e-09	220	438	160	380	Oleandomycin glycosyltransferase OS=Streptomyces antibioticus OX=1890 GN=oleD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999806	0.000212

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_121320-t33_1-p1.