CAZyme Information: ASPBRDRAFT_119807-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_119807-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	KV878681|CGC10	57607.48	5.1072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878681:3091599-3093293(+)

Full Sequence      

MSSTTPSSADYIIIGGGTAGLVIANRLSENPKVSVLVLEAGPDCTTDPRIQDPAGYVALQ
GSELDWKNKFVPQPALNNRALDHSAGKVLGGTSAINGAVYVPPSPAGIDAWAELGNAQWN
WESLAPYLRKSVSVSAPSEEACRGVGVQVEKFEADGPIQVMYPALANEKNHPLLKAWDET
FEKLGYPFTGDLLAEKRTVGTRAYTATVDPRSGLRSSADGAYAVEAGKRDNVTIVTGATV
RRILFDGSVATGVEVSLNGEASVTVDATKEVILAAGVFHTPKLLELSGIGDKDLLSSMRI
PVVVDNPGVGNNLQNHVMHVLPLPLNQVPELEGITPGVQALAFVRLGGEEQNSLAAKYLP
GEEGLDKVMRKILENPNEGSGFILFGVLPGASMGILGIIPCFPASRGHSHITSTDPDTPP
RADQCVFAHALDEELMARHLQQLQQIPTLPPLQHFFQPSSGPADLETTKQLLRTTTGIAS
HACGTAAMLPREKGGVVDQELKVYGTQNLRVVDASVFPLMPHGNPVSVVYAVAERAADII
RGAV

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_119807-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	541	2.8e-152	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.20e-111	4	542	1	533	choline dehydrogenase; Validated
225186	BetA	4.93e-95	2	543	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.15e-30	403	536	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.68e-28	74	316	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	7.63e-27	2	529	49	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25452.1|AA3_2	2.64e-177	1	542	1	527
CAK96464.1|AA3_2	7.76e-170	5	542	2	528
BCS12736.1|AA3_2	1.72e-169	1	542	1	530
QRD83786.1|AA3_2	1.42e-156	9	541	4	530
QMW32332.1|AA3_2	1.42e-156	9	541	4	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	7.05e-80	1	541	1	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	2.73e-68	7	541	4	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6XUT_A	1.44e-58	10	543	18	590	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
6O9N_A	3.81e-51	10	540	37	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4H7U_A	6.85e-50	6	540	36	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	2.54e-81	8	542	46	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.54e-81	8	542	46	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	6.20e-67	2	541	33	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5AUN2|XPTC_EMENI	3.44e-66	7	542	36	615	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A7MFA8|BETA_CROS8	1.88e-65	10	542	4	533	Oxygen-dependent choline dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000011

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_119807-t33_1-p1.