CAZyme Information: ASPBRDRAFT_119713-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_119713-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	KV878681|CGC15	52764.56	5.0303

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878681:126671-128209(-)

Full Sequence      

MAFSFVLRVLSSLLLVLQLSTAASTSTLRQCLLTAVQNDATLVAVDGDLLYQTLAVQVYN
KNWPVTPAAVAFPKSTQQVAAIVNCAASLGYKVQAKSGGHSYGNYGLGGTGGAISINLKN
MKSFSMNYSNYQATVGAGMLNGELDDYLHNAGGRAIAHGTSPQIGVGGHATIGGLGPAAR
QYGMELDHVLEAEVVLANGTVVRASSTQNSDLLFAIKGAGASFGVVTEFVFRTEPEPGTA
VQYSFTFGLGSTSSRADLFKKWQSFISQPDLTRKFASICTILDHVMVISGTFFGTKAEYD
ALGLADQFPGHTNSSVIVFTDWLGLVAQWAEQSILDLTGGIPADFYSRCLSFTEKTPIPA
TGVDQLFEYLDTADTGALLWFVIFDLEGGAINDVPMDATGYAHRDTLFWLQSYAITLGSV
SQTTYDFLDHVNDIIRNNTPGLGNGVYPGYVDPRLQNAREAYWGSNLPRLMQIKSKYDPT
DVFHNPQGVLPA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	57	268	8.3e-69	0.4497816593886463

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.12e-26	67	205	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	5.44e-26	59	489	21	456	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.10e-13	446	489	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
178402	PLN02805	3.06e-11	67	241	134	312	D-lactate dehydrogenase [cytochrome]
215242	PLN02441	5.75e-09	65	227	63	232	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17347.1|AA7	1.17e-188	24	489	5	471
QMW42271.1|AA7	2.96e-174	29	492	10	474
CCA70426.1|AA7	5.01e-174	13	492	36	518
QMW30198.1|AA7	8.43e-174	29	492	10	474
QRD86662.1|AA7	1.15e-173	29	492	19	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	1.05e-64	59	492	53	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6Y0R_AAA	2.91e-61	59	491	53	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
3HSU_A	7.26e-61	59	491	35	478	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
1ZR6_A	1.42e-60	59	491	35	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3RJ8_A	2.12e-58	56	492	26	472	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	3.77e-110	26	491	5	469	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	5.40e-64	59	492	53	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	1.50e-60	59	491	53	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	6.67e-60	59	491	54	497	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|E9F5F1|SUBF_METRA	6.13e-59	59	492	55	492	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999778	CS pos: 22-23. Pr: 0.9888

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_119713-t33_1-p1.