CAZyme Information: ASPBRDRAFT_117959-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_117959-t33_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706		78175.51	9.4067

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878680:2487452-2489572(+)

Full Sequence      

MPYTAPLKTSPSAQHIEHPELTPQSCPSSPTAVVSHHQRQHLPRSYSSTSFVRRHRRSPS
SSKVFVFPEPGGHSKVDHVTDPHASIRTSPPPISDAVIPPGALISPPESANNSSDEEVSY
PSQDGLQLKKLEAAVRSIEQRRVSSPERQSSSEVQPSSSMAAIAGGPVQPPRPPLSREAR
KISHSRSVTETAIDRKQEEALTSSPEESDRDDEPPVRHPMVRKKSGELVRPALRPPSARR
RPSSMPGTPTYAKAVHFDAQLEHIRHFLQLDKPQAVSADTSPVEDYDAAEEFPFKKGHRD
IPAFEWELGLSNFPTDSSSRAKQRVRLERLHLSSDKNTMIGVVGVANLAFHKHVAARFTL
DHWKTVSEVSAEYSDDPRRKPSLDGYDRFSFSIRLDDQANLERKTMFVCVRYNVAGEEYW
DNNNSQNYQVNFRRVPKEMPQAQAPPSTRPRTNLPRSRSFAGSNSRPHSMPPSFDALSDM
DKYISFGNPPTNGKKEHLGDDDPHDVELVAPIRRDKQNHQVFGNRYDFEASLSAAMQTKP
THDRTTLTARAKSKLPTHGSHSHSSERRTSQREENAPLPSRGSQQPGSSDRHKPSTIVSG
KPHRESSVYKELVDKYCFFGSGSVNYPSGAVGPVTASPDYETRTSSSSSSSSVSPCSSPR
MDAVYGGDSRHSPAAPSSPNHLGYTYLQPMQNSFLKDTQTPAIIQG

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_117959-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	322	430	2.6e-34	0.9813084112149533

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	4.32e-54	320	431	2	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	1.81e-09	347	430	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS08756.1|CBM21	0.0	1	706	1	705
BCR96239.1|CBM21	0.0	1	706	1	705
CAK37632.1|CBM21	0.0	160	706	1	546
QMW42372.1|CBM21	2.08e-271	1	706	1	700
BAE59674.1|CBM21	2.08e-271	1	706	1	700

PDB Hits     

ASPBRDRAFT_117959-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7TMB3|PPR3C_MOUSE	3.57e-11	312	448	137	284	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q5U2R5|PPR3C_RAT	8.56e-11	312	430	137	256	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|Q9VVY3|GBS76_DROME	2.71e-10	246	428	450	629	Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
sp|Q9UQK1|PPR3C_HUMAN	3.67e-10	333	486	163	316	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
sp|Q0VCR4|PPR3C_BOVIN	1.58e-09	322	430	154	256	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_117959-t33_1-p1.