CAZyme Information: ASPBRDRAFT_113249-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_113249-t33_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843	KV878679|CGC15	91466.55	8.4921

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878679:1993118-1996012(-)

Full Sequence      

MEKDPRLGCSDPGSSTYDQAPPPYSPYTDGGLVVESADVQANGRINVDLDSKLARTLASI
IELQQEDLQNPPPDYSEGQPVKDELLQCDIQLNIVIQIVGSRGDVQPFIALGTELQKYGH
RVRIATHDVFSEFVTQSGLEFYPIGGDPAELMAFMVKNPGLIPQISSLRAGEVQKKRAMV
NEMLHGCWKSCIEDDPVTKIPFVADAIIANPPSFAHIHCAQALSIPVHLMFTMPWTSTKA
FPHPLANLSSSEMNPSVANWVSYGVVEWLTWQGLGDVVNRWRASIDLEPIPTTEGPRLAE
TLKVPFTYCWSPALIPRPRDWPANIDVCGFFFRDPPSYEPPPGLKDFLKSGATPIYIGFG
SIVIDNPQKMTGIILEAIAKTGVRAIISRGWSKLGGGPNPNIYYIDDCPHEWLFKHVAAV
VHHGGAGTTACGLANGRPTTIVPFFGDQPFWGNMVANSGAGARPIPYASLSAENLAGAIA
FSLKPAAAESARDIALKMQHESGVAAAVRSFHRHLPLHKMRCSLIPNQPATWTYKRSKKS
LKLSKLAVQLLIDNGRLNANELRCNTVNPIYIENRRWDPVTGIISASTSTGSAMLKSTGE
MLYNPYKEYTSSRSLKPPISRTGSALSTTTMSSSSGSSSVLSETSRRPSEPKRTETATDS
KPHKNALATAGNVVGASLKGFGKFTGAYFKGVVVDIPYAAAEGFRQVPRLYGDEPKQYGS
VRDWKSGATMGGKNFVDGMTDGFKGLFTEPIKGAREEGALGAVKGFAKGTIGLATKVPSA
GIGLVAYPFHGIVKTIEAAVRSKTGKAILLARLRDGYGMTQRIHMSEDEQQYLIQMFEAL
MDR

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	119	514	4.7e-51	0.9659685863874345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.97e-83	92	514	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.49e-47	94	509	4	389	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	6.29e-26	94	242	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
227376	MRS6	1.67e-09	682	839	2306	2455	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].
273616	MGT	1.15e-07	103	507	7	381	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48301.1|GT1	0.0	1	842	1	842
BCS15859.1|GT1	0.0	1	840	1	840
BCS04269.1|GT1	0.0	1	840	1	840
CAP79869.1|GT1	0.0	20	838	18	838
BCS26658.1|GT1	0.0	19	841	23	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.14e-71	99	515	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.56e-71	99	515	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	3.33e-28	92	507	1	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	5.65e-27	92	507	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	1.71e-22	92	507	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	4.89e-129	92	523	193	618	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	5.94e-127	91	516	155	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	7.63e-76	92	516	1164	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|P0CN90|ATG26_CRYNJ	3.12e-75	92	531	1034	1476	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|P0CN91|ATG26_CRYNB	3.12e-75	92	531	1034	1476	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_113249-t33_1-p1.