CAZyme Information: ASPBRDRAFT_111870-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_111870-t33_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		38994.73	4.7020

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878679:2688619-2689791(+)

Full Sequence      

MFSFLFILGLALTPCAYAWNVPNLTHLVVFGDSWSDAGRLHYFLSHNGSVPPVGWIDNGD
TPAADGGRPWPSYVGQYTGADVYNYAVAGAVCSNDLTPRIAQPVGKLFPDVAGYQVPAFL
ADSQYTYSNGTMFMDAAPESTVYAIMIGGNDVGADGFLTDSQTPGTTIADYIDCVFHQID
RLFQHGARNFVIHTLGAMYLTPQYGMPNEGGLKATQYWPDKYSNTTGVSQRMLEQVALVN
AVYKARLPLEVEFQRRYPGAQFALVDLESLVSMIDIHKYPAGYLNGTSPYNVTGYTNHCS
LSGTDCVRYDNENRDAFMWYDELHPSEQTWRAYARILVDIISGSSKWATYISA

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_111870-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	27	335	1.7e-53	0.9850187265917603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.96e-38	26	339	1	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.02e-10	29	339	5	313	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	3.46e-09	8	334	16	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	2.00e-07	27	341	4	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	9.63e-05	27	285	1	206	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO14737.1|CE16	4.28e-110	19	350	43	370
QRD06747.1|CE16	1.60e-109	9	350	19	357
USW54667.1|CE16	1.14e-108	18	350	37	365
SMQ51055.1|CE16	3.20e-108	19	353	51	386
SMR54462.1|CE16	3.83e-108	19	353	35	370

PDB Hits     

ASPBRDRAFT_111870-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	2.63e-72	23	350	26	344	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1
sp|O80470|GDL38_ARATH	1.56e-07	29	327	51	358	GDSL esterase/lipase At2g23540 OS=Arabidopsis thaliana OX=3702 GN=At2g23540 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999732	CS pos: 18-19. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_111870-t33_1-p1.