CAZyme Information: ASPACDRAFT_81300-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_81300-t33_1-p1
• CAZy Family: GT57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632		71091.09	4.8056

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878985:796044-798333(-)

Full Sequence      

MHWISTWLLPLLASESLARSIGSIQHLSTRQTTDYAVKQPPLTTNWTDQVGTNPWPEYPR
PQRQRADWKNLNGIWQYQTATSLDAAQSPPFGQALAQEVLIPSCLESGLSGIQAESAFYS
WFRTNFTVPSSWSGQNVLLNFGAVDYEATVFVNGQQAGFHRGGYFEFTVDITPFVNATTN
NELLVYVHDPTDSDDYVIPIGKQHLVPSHIFYTPCSGIWQSVWIESAPANYITQLDLSGD
MHGQVNVTVHSATGNSTTVRIAIHEGDSEIGSSNGTSAQPFQFNVTNPKLWSPDMPNLYN
VTVTLGEDTVASYLGFRTISRGTVDGIERPLVNGNFTFLFGTLDQGYWPDGLYTPPNREA
MEYDLRVLKGLGFNMVRKHIKLEPALYYRACDELGLLVIQDMPSLRPLENDASGATILPN
ESQQQEFARQLELMIRQLKSYPSIFAWVIYNEGWGQVTSYYPEISLTDRVKQLDPTRLVD
STSGWHDHGAGDFHDNHHYANPQCGTPFYSIDSTPYDPARIAIQGEFGGLGHNVSIEHLW
NNPTAIQAINQTYEMDLDLAAWNYRSHQLLTELQDQVRRYACSAGVWTQTTDVEGEVNGL
MTYDRRVKRVDEGQWRDDIRGLYEAASSRRKS

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	61	507	1.9e-105	0.4946808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	1.25e-34	58	479	3	445	beta-D-glucuronidase; Provisional
225789	LacZ	6.57e-32	54	479	1	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	6.20e-23	122	493	113	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	3.95e-13	120	228	67	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
236548	lacZ	3.39e-12	122	479	124	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96616.1|GH2	0.0	16	632	15	635
BCS09120.1|GH2	0.0	16	632	15	635
CAK96276.1|GH2	0.0	16	632	15	651
BCR88823.1|GH2	0.0	1	629	1	634
BAE58640.1|GH2	0.0	1	629	15	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.23e-117	42	612	12	572	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ED2_A	4.19e-26	121	477	94	467	Chain A, Glycosyl hydrolase family 2, TIM barrel domain protein [Faecalibacterium duncaniae]
3GM8_A	1.40e-24	120	479	68	421	Chain A, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6ECA_A	3.95e-24	58	475	31	463	Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]
6D50_A	4.51e-23	61	452	28	426	Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	2.10e-28	120	477	105	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	1.04e-21	118	476	56	412	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|T2KM09|PLH16_FORAG	1.06e-21	121	484	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|P05804|BGLR_ECOLI	1.17e-18	69	479	13	441	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
sp|A7LXS9|BGH2A_BACO1	5.85e-16	63	452	42	437	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001142	0.998840	CS pos: 18-19. Pr: 0.9614

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_81300-t33_1-p1.