CAZyme Information: ASPACDRAFT_81108-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_81108-t33_1-p1
• CAZy Family: GT45
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
144	KV878984|CGC3	14865.40	6.1925

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878984:845931-846365(-)

Full Sequence      

MSRLYALLGLLASAAALNPSCSPGGNFDLTKWNLQLPTGSTGSPQTISGSSLAGCSGYSS
SVFYTDGSTGELVMTVPGSPSSAGCVTTPNSKHCRTEFREISPSSWSPNNGNNRLRVTLS
VPQPDDSSHGTVIGQIHIDDSISS

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_81108-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL7	27	144	1.8e-38	0.5373831775700935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400923	Alginate_lyase2	1.24e-30	27	141	1	109	Alginate lyase. Alginate lyases are enzymes that degrade the linear polysaccharide alignate. They cleave the glycosidic linkage of alignate through a beta-elimination reaction. This family forms an all beta fold and is different to all alpha fold of pfam05426.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ80219.1|PL7_4	3.18e-62	1	144	1	147
UKZ54441.1|PL7_4	3.18e-62	1	144	1	147
OTA01262.1|PL7_4	1.36e-61	9	144	11	149
QYT01729.1|PL7_4	1.57e-60	9	144	11	149
QKX60664.1|PL7_4	1.23e-58	1	144	5	155

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NDE_A	1.59e-41	17	136	3	126	Chain A, Glucuronan lyase [Trichoderma parareesei]
2ZAB_A	2.88e-08	19	137	1	111	Chain A, Alginate lyase [Sphingomonas sp. A1],2ZAC_A Chain A, Alginate lyase [Sphingomonas sp. A1]
2CWS_A	2.90e-08	19	137	2	112	Crystal structure at 1.0 A of alginate lyase A1-II', a member of polysaccharide lyase family-7 [Sphingomonas sp. A1],2Z42_A Crystal Structure of Family 7 Alginate Lyase A1-II' from Sphingomonas sp. A1 [Sphingomonas sp.]
2ZA9_A	1.02e-07	19	137	1	111	Chain A, Alginate lyase [unidentified]
2ZAA_A	2.64e-07	19	111	1	83	Chain A, Alginate lyase [Sphingomonas sp. A1]

Swiss-Prot Hits     

ASPACDRAFT_81108-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999774	CS pos: 16-17. Pr: 0.9687

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_81108-t33_1-p1.