CAZyme Information: ASPACDRAFT_79831-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_79831-t33_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	KV878980|CGC14	62674.73	6.6119

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878980:541146-543137(+)

Full Sequence      

MPGDPAWPSQSTWDLFDQLLGGSLLRPAPLAAPCYSGWLQFDNATCFHLSMNWINSSLHI
QHPTSVLSPLYEGRSCMPFGFNYTNTCTVGGYPTYVVNASTAAQVQLAVNFARNSNLRLV
VKNTGHDFNGKSTGKGALSIWTHWLKDKVFYPTFAADDGYVGPAMKLGSGVQAFEAYGFA
KQYNVTVIGGEGVTVGLAGGYTLGGGHSPLSSLYCMAADQVLAMQVVLADGRFITATAKQ
HADIYWMLCGGGGSTIGVVTSITVKAYPQIPATTVTFNFSVADTPSPDVFWAGFESYLDN
IERLVDAGTYAYYDLGASAAERGTNFPGDKDYYLRIQSLLAPNMTITETKRLLQPWFDRL
DTLNIRYTPQYNYAENFHDAWKSAFPQEYMGAATTKIASRLLPRKAYHDDGLRHRAFLAH
KDAVANGFSIAAFHLTGRGKLVEPPQNNAVLPAWRDTLTHAIVIGQWNSTSSWDVVVHTS
RSLTQWMQAMRNLGESGVYMSEADLLEPDLQDAYYGVNYPRLYALKQKYDPTGVFFALTA
VGAEDWTVLVEDPVPESWNTNGRLCPRRR

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	82	536	1.4e-47	0.980349344978166

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	5.28e-18	93	237	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.42e-17	91	535	30	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	2.84e-08	498	535	1	38	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.70e-70	2	565	504	1064
QKD57322.1|CBM91|GH43_11	1.70e-70	2	565	504	1064
QRD93627.1|AA7	5.32e-15	55	535	19	464
UDD63515.1|AA7	5.32e-15	55	535	19	464
QMW46638.1|AA7	1.66e-14	55	535	19	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	2.65e-103	1	565	31	572	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	1.05e-58	2	554	34	595	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6EO5_A	1.44e-18	93	535	48	462	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	2.55e-18	93	535	48	462	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
3RJ8_A	1.76e-15	93	541	37	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0E0RTV6|ZEB1_GIBZE	8.83e-105	2	565	31	561	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A1CFM2|PATO_ASPCL	9.17e-103	1	565	32	566	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|G2QDQ9|VAO15_MYCTT	1.36e-102	1	565	31	572	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1
sp|A0A075TR33|PATO_PENEN	3.54e-98	1	569	31	569	FAD-linked oxidoreductase patO OS=Penicillium expansum OX=27334 GN=patO PE=1 SV=1
sp|G0R6T3|SORD_HYPJQ	4.93e-95	2	546	43	562	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_79831-t33_1-p1.