CAZyme Information: ASPACDRAFT_79469-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_79469-t33_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412	KV878979|CGC6	46357.73	6.4392

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878979:71810-73230(-)

Full Sequence      

MAPTRLRRLAIFALLGAVLMIWTLYQREEWDNELMTLDNQYPFLYHHVHTHHAEGGAWYI
PPTWMSASDHQPKNIVEAAELALGLVNTAERYLPHSAIPMVVHQTWKNTHIDTWPQLLRH
SAERWLQATDGQMAYFLWTDAGMTQLIRKVEPALEVQFASLASNVERSDVFRILVSKWIG
GVYGDIDTEPLRPPTKWLSATDLLPWNDTQTGIVYSSTSPVHAIVGLEADCREDTDTYWR
MGYSQPVQLTQWAFAWAPGHPILQTFLDRFSTTLTNISDRYGGSLNSRAARQELLALDPL
TLTGPATFTDAVRGRLEEVADLRWQALSGLQDGGRSKLVDDVVVLPITGFSPGRGAYGNM
GSKPITDPSARLRHLAQGSWRAFDLTVEYGKFCRTVLGMCRDWSKVPTAAIV

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_79469-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.71e-16	92	278	76	251	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.38e-06	135	204	20	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK37855.1|GT32	7.51e-283	1	385	1	385
CAK38082.1|GT32	3.08e-236	1	411	1	412
BCR93027.1|GT32	4.38e-236	1	411	1	412
BCS05686.1|GT32	4.38e-236	1	411	1	412
UDD65561.1|GT32	9.00e-163	5	406	7	410

PDB Hits     

ASPACDRAFT_79469-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	7.02e-23	158	381	202	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.84e-21	72	381	100	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	3.00e-14	92	381	90	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	2.31e-11	92	351	124	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	2.62e-08	96	201	55	162	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999993	0.000024

TMHMM  Annotations     

Start	End
9	26