CAZyme Information: ASPACDRAFT_77063-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_77063-t33_1-p1
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477		52019.30	3.9088

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878974:326969-328402(-)

Full Sequence      

MPILVANVLNGPDSTVDSSWQDVIERASSAGKTVLGYVRTGYLGVSDQIFQTRLGSGNLA
DWTAQIEEDVDMWYKLYGDSIGGIFFDEGWPECGINDEYVDLYKYINAYTKRAHPGAYTV
LNPGSPMASCFEDTMDTLLTFEQSYDSYIDNYTPNDWTPRDPRKLWHTVYNVSESAVSEV
VQLAKERGAGFLQLTDDMLPNPYDTLPADSYIQSLMDGIDGGSLSNAGAVDWESDGAPGA
VTGLTVMTSDYSSAKLSWAAASNAQGYHVYASGSLAASVPSSMTEVTIGSLASGTSYTIY
VSAVGEGGELGSSSNQVTVTTKRLPGGRTVTNYKSSPRENSTVIEADVLVPYSSVRLYIW
HSLECDLDEDPGWGINFNVDNYVYTHYMVDGRTLYRYDGVFVTGSTAPPWSWEVTDTVML
DISGYTYTWTLPLGTSTVDTSKFVVQAQGYNPMINAFEPDPSDYDCQGSSVCTTPEC

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_77063-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	5	207	8.4e-17	0.8270042194092827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	5.08e-41	3	217	25	236	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.
238020	FN3	2.77e-08	238	321	1	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
214495	FN3	2.60e-05	238	309	1	82	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
165513	PHA03255	8.13e-04	220	343	33	155	BDLF3; Provisional
394996	fn3	0.001	239	313	1	85	Fibronectin type III domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS11365.1|GH0	2.59e-164	3	474	519	1009
BCR99052.1|GH0	2.59e-164	3	474	519	1009
UNO38501.1|CE3|GH0	1.76e-118	1	464	525	990
SBO94845.1|GH0	2.57e-56	3	444	48	573
UBU17109.1|GH135	3.10e-56	3	444	63	588

PDB Hits     

ASPACDRAFT_77063-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPACDRAFT_77063-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_77063-t33_1-p1.