CAZyme Information: ASPACDRAFT_76732-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_76732-t33_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565	KV878973|CGC7	60644.40	4.3672

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878973:1520389-1522210(-)

Full Sequence      

MKASWALAAATAALTSTVSATDASDCHCLPGDDCWPSTSSWDTLNSTVNGRLIATVPIGT
PCHAPNYDAAACKELQSNWYYPQTHMDTSSSVMQTYFANQSCDPFTSVDRPCLLGNYVDY
AVNVSSSDEVVAAINFAKSNNIRVVIRNTGHDYLGRSTGAGALAIWTHHLNNIEYVDWSD
STYTGPAYKLGSGVMGFQVLDAVHANGHVVVGGECPTVGLAGGYLQGGGHSALSTSFGLG
ADQSLSFEVVTAAGDVVTASRTNNTDLYWALSGGGAGNYGVVLSVTVKAYPDATVSGAGV
EFTAANVTTDVFFEGVARFHELLPAMIDAGTTVIYEMTNSIFLINPLTGFNKTTDEVKTI
LAPFLSALTDLGITYAVSYTEYDSYYEHYEKYMGPLPYGNLDVGTYNYGGRLIPRSVLDS
NVTPLVSALRNITSEGIIAVGVGLNVTSSNDVANAIFPEWRKAAVTMQIGAAWNETAPWS
QMVEEQYQMTHQAVPQLEAATPGAGAYQNEADFNQLNWQETFFGSNYDNLTQIKNKWDPD
HVFYVLKGVGSEYWTVSESGRMCKA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	122	319	3.1e-42	0.4126637554585153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	1.61e-23	85	543	10	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	9.43e-20	119	260	2	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	1.57e-12	506	544	1	39	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	0.009	248	282	198	231	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.40e-69	26	564	500	1065
QKD57322.1|CBM91|GH43_11	1.40e-69	26	564	500	1065
UQC87672.1|AA7	3.35e-17	121	551	71	497
UPK90596.1|AA7	1.45e-15	129	549	31	441
QRW06655.1|AA7	2.87e-15	122	551	72	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	1.05e-151	7	565	9	574	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	4.19e-73	26	564	30	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6EO5_A	7.88e-18	129	543	59	462	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	3.29e-17	129	543	59	462	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6FYE_A	4.08e-17	125	282	52	201	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0E0RTV6|ZEB1_GIBZE	1.61e-215	20	565	21	563	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A0A075TR33|PATO_PENEN	9.72e-178	18	565	20	567	FAD-linked oxidoreductase patO OS=Penicillium expansum OX=27334 GN=patO PE=1 SV=1
sp|A1CFM2|PATO_ASPCL	1.42e-177	23	564	26	567	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|G0R6T3|SORD_HYPJQ	1.73e-160	12	564	25	572	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1
sp|G2QDQ9|VAO15_MYCTT	5.39e-151	7	565	9	574	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000285	0.999692	CS pos: 20-21. Pr: 0.9577

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_76732-t33_1-p1.