CAZyme Information: ASPACDRAFT_74022-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_74022-t33_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	KV878970|CGC15	32034.83	4.0413

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878970:358203-359147(+)

Full Sequence      

MKQTGSILALAGLVSMANAHGFVTSPQPRMPGSAMEKACGQQVYNNQEADNYGNIQGELQ
IASGQSDYDAEACDIWLCKGYKYADNTANVQSYKPGEVIDFTVDIRAPHTGTANVSVVDT
ATNTMLSQPLIYWSVYASTATGVTANETSFSVTMPTDLGDKCNEAGACVLQWWWDARSID
QTYESCVDFTLSGSSSSSSSSSSSSSSSSSSSSSSSSSAAAAVATSAASSSTSSAAETTT
AASAAVTSPAAANNIAPVSSSGPTTLATSVKQTATAAAVSSATSTSVSLPTDGTAEEQLT
WVASVFKALLNYAN

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_74022-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA16	20	189	5e-72	0.9940119760479041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	1.03e-06	20	189	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05968.1|AA16	1.88e-123	1	314	1	299
BCR93324.1|AA16	1.88e-123	1	314	1	299
CAK37296.1|AA16	4.73e-121	1	314	1	297
UDD64172.1|AA16	8.00e-102	1	312	1	282
BAE64879.1|AA16	9.14e-102	1	312	1	286

PDB Hits     

ASPACDRAFT_74022-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPACDRAFT_74022-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000697	0.999264	CS pos: 19-20. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_74022-t33_1-p1.