CAZyme Information: ASPACDRAFT_62073-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_62073-t33_1-p1
• CAZy Family: GT109
• CAZyme Description: carbohydrate esterase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	KV878981|CGC2	22959.09	6.4359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878981:11640-12626(-)

Full Sequence      

MVQGSNVDLRLKLNLASPVPAPAPEAGQLQTRQFMDSNDLTSGSCKDVTLVFARGSTELG
NMGSVIGPPLCTALKSKLGADKVACQGVGGLYTAGLMQNALPQNTDPGAISAAKSIFEQA
ASKCPNTKIVAGGYSQGSAVIDNAVQAVSSSVRDQIKGVVLFGFTRNVQDHGQIPNYPKD
DVKVYCAVGDLVCDATLIVTAAHLTYGLDAGDAANFLASKVNA

Enzyme Prediction     

EC	3.1.1.74:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	44	220	2.7e-45	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	3.18e-61	44	221	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99223.1|CE5	1.02e-115	23	223	23	226
BCS11530.1|CE5	1.02e-115	23	223	23	226
QMW46952.1|CE5	5.32e-115	1	223	3	223
QRD91206.1|CE5	7.56e-115	1	223	3	223
QMW34880.1|CE5	7.56e-115	1	223	3	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	7.43e-72	29	221	5	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	8.24e-69	38	221	5	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	4.92e-63	38	222	16	199	Chain A, cutinase [Malbranchea cinnamomea]
1XZJ_A	1.28e-61	20	223	6	209	Chain A, CUTINASE [Fusarium vanettenii]
1XZG_A	3.65e-61	20	223	6	209	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NCM8|CUTI3_ASPFN	1.34e-115	1	223	3	223	Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_039350 PE=3 SV=1
sp|Q2U199|CUTI3_ASPOR	1.56e-114	1	223	3	223	Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000113 PE=3 SV=1
sp|A2R2W3|CUTI1_ASPNC	4.11e-114	13	223	16	226	Probable cutinase 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An14g02170 PE=3 SV=1
sp|Q5AX00|CUTI3_EMENI	1.55e-97	14	222	13	220	Cutinase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut3 PE=2 SV=1
sp|Q0CNE3|CUTI3_ASPTN	5.70e-97	16	221	13	217	Probable cutinase 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_04791 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999842	0.000207

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_62073-t33_1-p1.