CAZyme Information: ASPACDRAFT_61148-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_61148-t33_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	KV878978|CGC13	69344.93	4.8594

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878978:1016937-1018829(+)

Full Sequence      

MHTSSWLLFGLAAAVFAQEEQDLNLFHYGRRGPLLGTSFGTPGANATFDYIVIGGGTAGL
TIASRLAQSERFSVAVVEAGGFAEIDNGNWSVVPAYARGLFCGDAPEAYHPLNDWRFKTQ
PQQVLGGRVFHCAHGKLLGGSSAQNSMNYNRPTKGSMQKWAEEVDDESYTFENMLPWYKK
SVRFTPPDPTIWSDYDILHNEDAFNDGGPLEVSSGNWIDPLANTVRKVLTDGLGFKETEF
NSGGLLGSGFMSRTINPKNAHRSSSESSFLQEALDSGNRLTIYKNTLAQKILFNGGDKTA
SEVLVSTAGTFGTSNLDFYLRAREEIIVSAGPIQSPQLLMVSGVGECEQLSRYGIPCVSH
LPGVGKNMQDHPVVITMCRVNEQMVPFLVTEEASDQLHVRQYIENARGPLTIVGPGYFGF
EKLPQQYRSQLTEENLKSLADFPKDWPELEWALSGVSRDTDASERNYTIAMGSIVQATFS
RGMVSLASPDMSTPPIIDPQWLADPRDMDTSIQAFRRSREIWTHLAEVGVIDLETCVPGS
EVETDYQVREFLRQDASAINHASCTCKMGQKDDRMAVIDNVARVFGVQRLRVVDISSFPF
LPPGHPQATVYALAEKIANEILQASINFSS

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_61148-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	47	623	4.8e-161	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.55e-85	44	625	4	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.53e-85	44	622	2	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.17e-38	479	617	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.35e-30	7	623	10	578	Protein HOTHEAD
366272	GMC_oxred_N	4.96e-24	126	373	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44482.1|AA3_2	5.68e-235	8	622	9	621
BCS06538.1|AA3_2	1.27e-231	8	622	10	622
QMW37598.1|AA3_2	2.00e-231	10	624	7	627
QMW25513.1|AA3_2	2.00e-231	10	624	7	627
QRD88504.1|AA3_2	2.00e-231	10	624	7	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS1_AAA	4.84e-52	41	618	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	9.18e-52	41	618	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	1.19e-51	41	618	17	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	1.26e-51	41	618	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
7AV4_AAA	1.54e-51	41	618	77	633	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	7.11e-146	34	621	38	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	1.41e-142	28	621	35	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	7.36e-138	35	622	23	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	2.27e-132	34	622	32	594	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.74e-129	45	621	38	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002196	0.997795	CS pos: 17-18. Pr: 0.9574

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_61148-t33_1-p1.