CAZyme Information: ASPACDRAFT_55516-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_55516-t33_1-p1
• CAZy Family: GH76
• CAZyme Description: glycoside hydrolase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440	KV878992|CGC3	47436.67	4.5321

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878992:174099-175577(-)

Full Sequence      

MARTTFQNFLKAAYAATLVAGTVSAIGLDINNKKSIKDAAATAAFNTMQHYNGNKTGGIP
GVIPSLWAEGGILFNLMIQYWYFTGDASNNAAVTQGMYWQIGDNDYMPSNWSSQIGNDDQ
MAWGLAAMTAAELDYPEDVNQPSWLTLAEGVFNTQVARWDTSNCGGGLRWQIWPFNSAYT
LKNAISNGGLFQLSARLARYTHNQTFADWAEKIWDWSASVPLLNNKTWSIADSTDVDNGC
TTQGNNQWTANYGPYISGAAYMYNFVSHCNKWKSGLDGLLNVSLGTFFPEKYGGLILSEI
LCEPTQVCNSFEDTYKGNFVSDLTLASLVAPYISSEVSSRLQASAVGAAKQCTGGNNQTL
CGRRWDSDEWDGTDGREEQLSATSIFFANLAGFTEKGVATAAAAANHTTGSAGTNRTSTN
GTISVVTAGVLAGLASLFVF

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_55516-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	33	397	8.1e-83	0.946927374301676

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.44e-157	35	382	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44952.1|GH76	1.61e-190	6	428	3	423
BCS13375.1|GH76	3.61e-182	6	426	3	430
BCS01664.1|GH76	3.61e-182	6	426	3	430
BAE55608.1|GH76	1.04e-164	14	397	15	397
QMW38383.1|GH76	1.04e-164	14	397	15	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	6.80e-79	30	395	30	408	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	2.80e-92	24	385	20	380	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	3.10e-87	17	385	5	377	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	2.41e-85	16	390	10	384	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	1.78e-84	25	385	18	383	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q5ACZ2|DFG5_CANAL	4.19e-82	18	415	14	411	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000840	0.999103	CS pos: 25-26. Pr: 0.9737

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_55516-t33_1-p1.