CAZyme Information: ASPACDRAFT_54468-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_54468-t33_1-p1
• CAZy Family: GH75
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	KV878985|CGC1	46804.14	6.9579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878985:667699-669006(+)

Full Sequence      

MGLIRFTSLLFTYVSSRRLTFLALVIAVWLLCSRLPGLDLYANQQVVRDHGRGENGGRFL
YVSPFRHNPDLEYERKLANALQELEHTVLDQQGGNNVAEDRIWQIAKDDSQRGPDSAYLQ
ERNPGWGYTLMSDAKASKFVAETFSAVPEIAQIYESYPYHVLRADLLRYLLLYYHGGFYA
DMDIYPARPINECPALQSIPKLSMDASIDSANVSLVVGVELDEPYASPQTMSYWRWTRSY
GLIQYTMYAPRRFSPLLREIIVRCLSHTRQYYRQHSGFLNRFSYDKNAILGITGPDVLTD
AILDALSASLPGSHPFVQKSVGMDQDTGDLVAPAGKMERRVTWAPFHDLHEPLCVDASEA
VPETPMGGLCVVPISVWGNGQRHSKAEGFNSPHACLNHRFGGSWKKGWRERLFG

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_54468-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	120	193	3.7e-19	0.8333333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.16e-08	99	191	83	175	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.04e-07	123	195	15	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK43033.1|GT32	1.95e-162	58	414	37	395
CAP98643.1|GT32	6.43e-160	13	414	14	421
QKX54668.1|GT32	8.73e-151	26	414	16	403
QMW25899.1|GT32	5.35e-147	58	414	60	413
QRD88070.1|GT32	5.35e-147	58	414	60	413

PDB Hits     

ASPACDRAFT_54468-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	5.43e-20	120	405	128	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.24e-18	102	405	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.82e-17	102	352	134	347	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.95e-16	101	406	102	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.97e-07	123	184	85	143	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997213	0.002797

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_54468-t33_1-p1.