CAZyme Information: ASPACDRAFT_53996-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_53996-t33_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866	KV878983|CGC4	94810.47	4.3764

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878983:640173-643100(+)

Full Sequence      

MRLRYSLHLWGLFAVPGVLAQDIDYSAAAQSISAELAGPSFVPYIRPTQKILEFIAVGDS
YTAGTGCNGIDEKLGGDAIRGQPSTPILATRQRRDALYNSILNDCIYKAYKAGDCQSTLD
KLQDELDSGSFKDKVNLALYQVAHAGRQAGGSEPRESFQVFVLEYVTFFGMGPECNDYTW
SIWPGWWSEQPKLTLELRQQLNDKVRQVNAAIKAAAEDLKAMGVIYVEGIQDAYNGHRYC
ESGASRDMTEYSVWFWSPNNHINTPSEGPGDPSNAASTDRVDLAQGLLDFMFPGQGKVVP
TAESVNSTPPWEWEGAEKYPDWQSLLDALHDAAGDDANAQNLVPLQYMRTFHPKATAYAT
HAEELFAAIANNRGAAGAAGDGGQQIAIASYINPLADPASWQRLLAYDTKKVTVMVANVL
NGPDYVIDDSWKSVIDQAASQGKRILGYVRTGYLGVSQQQFTTRLGSHDLADWASQIEQD
IDKWYELYGTSLGGIFFDEGWPECGPNNIYADLYAYINNYTKRKHPGAYTVLNPGSPIAQ
CFEDTMDTLLTFESSYETYTNSFVPNDWTPKDPRKIWHIIYKVPQSQITRVAALASSRNA
GLLEITNDDQPNPYDNLPDEAYMQAVIGAVPGGTPLIDDPAEATNSYVAGLPSDVIVSSS
DYSSVTLIWSSVPDALGYAVYKNGAQILEVPPSLTQATVGMLEPGTSGITFEVRSILSSN
SGGSPRTITASTKSLPEEVPYAFVRLFIGINQPSHGGVHGWPIQVPGVDAQGVAWHEVVN
YLVEGNDFYSGLYKYSGAWDDTSKVNADWTWTSIGEATQSQDGYTYTWSVPLAGTDAVAS
EYVIQGQGYAPIKNIFKGTLYSYREL

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_53996-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	387	619	1e-21	0.9578059071729957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	7.70e-42	391	630	1	238	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.
238861	SEST_like	1.29e-12	54	243	3	224	SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS11365.1|GH0	2.44e-159	87	856	140	975
BCR99052.1|GH0	2.44e-159	87	856	140	975
UNO38501.1|CE3|GH0	5.72e-108	377	856	489	983
BCJ74410.1|GH135	8.33e-55	384	742	40	390
SBO94845.1|GH0	2.61e-54	384	707	19	342

PDB Hits     

ASPACDRAFT_53996-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPACDRAFT_53996-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000286	0.999679	CS pos: 20-21. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_53996-t33_1-p1.