CAZyme Information: ASPACDRAFT_53150-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_53150-t33_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	KV878979|CGC12	42199.54	4.0716

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878979:1325589-1326919(-)

Full Sequence      

MKSFVCLLAFPASSLAGTVLWSGIFNSSATVEDFDDWSWSNQIEPWQWYIHGTGNTSDYL
GLSTDFKNPADTSDAQGLRISIDGTSYWEGQTMERSELIPQTKADLGSGHLYYHFSLSTK
TTNAPNASFEHQIAFFESHFTELQYGLASGASGSSDNTLRWNAGGNTHWSVQLEAGNWYN
FAYDIDFDAQTVGLWASNGSDPLTEVVSPVSASASSNSADWHVGELRLPGSGASNDAAED
WFWSGIYIEESPITKEIGSGSASSSSSSSSSADTSSSVSSASSSTSSAPQSTVEATSSTT
VAAATTSTAASATTSATQTVATVEPAVVSSAATSSVTTAAVAVTSAVASSVTTEVAVEVA
TTATAASVALASPTTPTEILDDIRAIFGALVSRSSGVHARDFARRA

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_53150-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	19	260	9.8e-103	0.996078431372549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.11e-73	19	251	1	248	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46856.1|GH131	3.07e-148	1	405	1	378
QMW34786.1|GH131	3.54e-147	1	275	1	269
QRD91104.1|GH131	3.54e-147	1	275	1	269
UDD63765.1|GH131	3.54e-147	1	275	1	269
BAE64574.1|GH131	7.11e-147	1	263	1	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LE3_A	2.90e-95	17	257	1	240	Chain A, Beta-glucanase [Podospora anserina],4LE3_B Chain B, Beta-glucanase [Podospora anserina],4LE3_C Chain C, Beta-glucanase [Podospora anserina],4LE3_D Chain D, Beta-glucanase [Podospora anserina],4LE4_A Chain A, Beta-glucanase [Podospora anserina],4LE4_B Chain B, Beta-glucanase [Podospora anserina],4LE4_C Chain C, Beta-glucanase [Podospora anserina],4LE4_D Chain D, Beta-glucanase [Podospora anserina]
3W9A_A	2.27e-87	17	263	1	237	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

ASPACDRAFT_53150-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000512	0.999465	CS pos: 16-17. Pr: 0.9725

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_53150-t33_1-p1.