CAZyme Information: ASPACDRAFT_52744-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_52744-t33_1-p1
• CAZy Family: GH67
• CAZyme Description: glycoside hydrolase family 95 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1299	KV878978|CGC4	142932.01	5.8482

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878978:980654-985946(-)

Full Sequence      

MPQVKSVAIIGTGPAGAIAVDALAQEKAFDRIRVFERQEKAGGCWVARPEEKAVALDVEK
LSARIADAPLPIPESLPQYTPASSQHRFTDSHVYPNLHTNVDAATMGYSLEPIPVVRSEW
SIGLHGPDTPFRHHTVIRQYVEDLLNRNGYQDLVEYNTTVESAVKDPQSDKWVLTLRRAG
EPGGDDYWWSETFDALVVASGHFAVPYVPAIPGLKDFVEKYPENVLHTKQYRGPEQFRGK
KVVTVGASVSAADTAVSLIGSAQSPIYAVVRGKYNPYFGDEAFKHPQIERRPPIARISCE
NGDRTVHFEDGTSVSDVDYIIFGTGFTWTLPFLPNIPMRNNRIPDVYLHVFHRQDPTLMF
IGGVGAGLTFKIFEWQAVAAARVLAGKAHLPPHEERQKWEQDRIAKKGDGPGFLMINPEF
EEYFEQLRQLAGEPKEGEPGRRLPPFEQSWVDLFNAGHERRIEMWKKANATAAGSRLYLL
VLPLVAAKSLWSDSPGNYSSIITTAFPLGNGRLGGMSAYTGGNPNVSKADALPGIREWIF
QNGTGNVTALYGDFPDYGSYQVLGNLTIDLGELGAVSNYRRSLDLESGVYLDQFKTGNVD
ITREAFCSYPDQVCVYRLASNRSLPAITFGLENQLSSPTPNVTCQGNSISLYGVTAPTIG
MIYNARATVVVPGAETSSNYCSRNNATLNVSKGQREVFLIFAAGTNYDAAKGNAAAGFSF
RGQDPYQQVLQTATSAAKKSYAQLKSAHLKDFQALSGTFELTLPDPNNSSSKPTTELISS
YTLPGDPFVENLLFDYGRYLFISSSRPGSLPPNLQGLWTESYSPAWSGDYHANINLQMAH
WAVEQTGLGELTEPLWRYITETWMPRGAETAELLYGASSGWVTHDEMNTFGHTAMKNDAQ
WANYPVSNAWLAHHVWDHFDYTQDSAWYEETGYPILAGVAEFWLSQLVEDEYFHDGTLVV
NPCNSPEHGPTTFGCTHYHQLLTELFTHLLTTPSQKTANNSLQTTLRKTLAHLSPGLLIG
SWNQIQEWKLDLDTPNDTHRHLSNLYGWYPGSSISSPFGRNTTVTAAVTTTLISRGNGTE
DQNTGWAKVWRSACWANLNDTAHAYAELTLAIQENFGPNGFSLYGGSVPFQADANFGVVG
AVLEFLVRDKDLSYARLDAANEKEGSGGKVWQEVVLGPAIPDAWGNGEVKGVRVRGGGRV
SFGWDAEGVVDCPYFHLRHHAPSQQPHGLPPQNPRQIGMAGIGLAVTILPAQTQEGRILT
THLDITDRPAVDAWIQQTVTHLGRLDGAANMAGSTAWAR

Enzyme Prediction     

EC	3.2.1.63:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	488	1209	1.2e-195	0.9542936288088643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
405224	Glyco_hyd_65N_2	1.33e-57	490	709	1	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
215116	PLN02172	4.70e-31	5	395	11	359	flavin-containing monooxygenase FMO GS-OX
224983	CzcO	5.21e-30	1	265	5	201	Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD [Inorganic ion transport and metabolism].
395602	FMO-like	5.40e-30	5	395	2	403	Flavin-binding monooxygenase-like. This family includes FMO proteins, cyclohexanone mono-oxygenase and a number of different mono-oxygenases.
404603	Pyr_redox_3	3.02e-11	191	346	115	280	Pyridine nucleotide-disulphide oxidoreductase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48586.1|GH95	0.0	471	1211	4	763
BCS03365.1|GH95	0.0	471	1211	4	759
BCS14993.1|GH95	0.0	519	1211	29	711
CCD42397.1|GH95	3.27e-246	485	1210	19	768
ATZ52972.1|GH95	6.52e-246	485	1210	19	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UFC_A	2.09e-84	477	1204	9	721	Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	6.24e-82	470	1205	23	738	Chain A, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2RDY_A	8.65e-78	499	1204	11	732	Chain A, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
2EAB_A	3.02e-56	504	1204	50	829	Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	1.69e-55	504	1204	50	829	Chain A, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R797|AFCA_ASPNC	0.0	471	1211	4	763	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
sp|Q5AU81|AFCA_EMENI	1.91e-220	488	1211	20	782	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
sp|Q2USL3|AFCA_ASPOR	5.52e-180	484	1211	12	701	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2
sp|Q8L7W8|FUCO2_ARATH	1.98e-83	503	1211	64	799	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
sp|B8NM73|USTF2_ASPFN	1.79e-45	2	456	4	483	Flavin-containing monooxygenase ustF2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=ustF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000005

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_52744-t33_1-p1.