CAZyme Information: ASPACDRAFT_47338-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_47338-t33_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: carbohydrate esterase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237		25353.30	4.6508

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878987:521799-522733(-)

Full Sequence      

MIANTLTVLALNALIGLAQAALINGTECADVHFMLARGTTEDYPGTTYTMAELAAANMTT
LTTNYESIIYPAVSETSSDSYFVGRAAVGSQVNRYAAACPRSKIVLISYSQGAMIVGDAL
AGGGGDSTLGNATEPLISEEVSKHIAANVYYGNPRHAPYQPYNMGNNTWNVTGKYPRLDY
QINYLHDRYRHVTADWCNNGDGVCSPSEGADSLSLHMAYASDYDPIAAAWIVEKLGA

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_47338-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	27	235	1.3e-41	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.07e-20	28	235	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK49022.1|CE5	2.16e-148	1	237	1	236
UQC76608.1|CE5	6.31e-61	2	237	10	241
CCD43014.1|CE5	8.02e-58	21	231	27	231
ATZ51287.1|CE5	8.02e-58	21	231	27	231
ATZ52428.1|CE5	1.29e-56	21	235	27	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	2.38e-11	28	235	2	206	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
2AXE_A	6.18e-11	27	236	1	207	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1BS9_A	8.49e-11	27	236	1	207	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.17e-10	66	236	39	207	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2J8C362|CUTI1_VERDA	1.09e-12	18	235	15	229	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.21e-10	27	235	32	237	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|O59893|AXE2_TALPU	1.26e-10	13	236	9	234	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A6WFI5|CUTI_KINRD	2.82e-08	28	222	36	204	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000253	0.999713	CS pos: 20-21. Pr: 0.9721

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_47338-t33_1-p1.