CAZyme Information: ASPACDRAFT_44237-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_44237-t33_1-p1
• CAZy Family: GH32
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		38053.99	8.4907

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878979:74699-75843(+)

Full Sequence      

MASLRVRLLFVAVTVITLAGLFLPMHELYLLLRLPFVWKTSAADSILSAQRDGFDVTFAS
YANSSGLQENAGIPNRLHHVHLGPSAPRAEWLSARAQCLDHHPDWEVFLWEDENSREFVK
SQYPHLLAMWEEYPALVQRVDALRYMVLHTYGGAILDMDLACRQSLDPLREFEFVAPAAH
PVGISVGMMLAAPNNAYVRALVDNLPRFNRRWSLLPYITIMFSTGCHYASTIFTLQSNRS
ALRVLAGTPDHPTLNMLNGYVNTPLFQHLGTSSWHGRDARWIKFFAHCDQRLSFLVIVVF
LLSFAGAVCFCVARGRRAARRPDPTRTEAIKSEGKMV

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_44237-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	91	170	8.1e-19	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.39e-25	73	283	82	289	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.99e-15	90	173	3	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05573.1|GT32	1.28e-144	1	316	1	320
BCS17124.1|GT32	1.28e-144	1	316	1	320
CAK44892.1|GT32	4.26e-142	1	312	1	316
UDD65563.1|GT32	6.24e-136	27	326	28	329
QRD92706.1|GT32	5.08e-135	27	326	28	329

PDB Hits     

ASPACDRAFT_44237-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.60e-38	69	322	53	309	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.66e-36	73	304	82	308	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	7.78e-33	73	304	55	278	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.67e-32	63	320	54	305	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	1.34e-31	52	304	48	286	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.970711	0.029316

TMHMM  Annotations     

Start	End
10	32
213	235
291	313