CAZyme Information: ASPACDRAFT_42675-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_42675-t33_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514	KV878976|CGC4	56919.37	5.2502

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878976:82391-84031(+)

Full Sequence      

MLRVALLHFTLHIIHAVVAWQVPAEYAITPSPDGRFLQQSNGKPFFWQADTAWLLFHRLN
HSEAETYLSDRARKGFTVVLAVGFTQEGITNPNRNGDLTFIDEDVTRPNEAYWAYIDSIV
ALAWSKGIRICLVPAWGKFVHGSDNSASVLNSTTASPFGHFIGQRYPYLPKTLVADTNPY
WQNKTAVKADYLRGGVSPTHEVVDWSPVYDALAEGIVAGERQAIKSASSPSSAADKWQPL
MTIHPTNQWFTGGPIALAHAFFGNRSWLTLDTSQSGHTDYAPNPPIPWWNCRRGWEPVER
MYVGGNPSQQQPGSKPRPVLDNEAHYEHRYNDGNPDSFYWNASDVRIGSWQAVFSGAAGL
TYGANAVQQIAIPGLYASDGSGPGDDWEQDLVLPGSSQMQWIQKVVIDRGQDSYFRRVPA
QDLLVGEVGADDARVTATRDRGGDWILVYTPTGQEFQVNTGGLGSCQVRASWFDPLDETY
TSLEYAQCGQGSVRTFTPPVGQGHEDWVLVLEVV

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_42675-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	233	509	3.8e-43	0.5825242718446602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	3.48e-83	33	404	1	315	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.10e-30	418	512	1	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAB8252452.1|GH140	5.23e-297	1	514	2	510
KAE8135280.1|GH140	1.50e-296	2	514	3	510
UDD60585.1|GH140	3.02e-296	1	514	2	510
QMW31657.1|GH140	6.08e-296	1	514	2	510
QRD90675.1|GH140	6.08e-296	1	514	2	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	4.13e-45	31	511	21	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	2.55e-41	31	511	21	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	4.35e-39	31	512	34	462	Chain A, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

ASPACDRAFT_42675-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000335	0.999634	CS pos: 19-20. Pr: 0.9503

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_42675-t33_1-p1.