CAZyme Information: ASPACDRAFT_36871-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_36871-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848		92827.41	5.3074

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878991:108313-111032(+)

Full Sequence      

MPFVEPPLPETDSAFAQIANADVEVLLKQLTLDEKVALLTGDDFWHTVAIPRLGIPSIRL
SDGPNGVRGTRFFGSVPAACLPCGTALGATFDRDLAEEVGGLLADEARAKGAHVILGPTI
NIQRGPLGGRGFESYSEDPLLSGIMAGHYCKGLQQKNISATLKHFVCNDQEHERMAVNSI
VTDRAMREIYLLPFMLAIGVEKPDAIMTAYNKVNGIHASESPNLLQDILRGEWGWDGLLM
SDWFGTYSTSEAVQAGLDLEMPGPSRWRGSALTHAITANKVSTATLDARVQAVLKLIQKA
SRSGIPEHAPEQQLNREEDRQLLRKIAAEAIVLLKNENSILPLNKHKKIAVVGPNSKIAT
YCGGGSAALNPYEAISPFEGIERVAQADVEFAQGVYGHQMLPLLGKRLQTSDGQMGFTLR
IFNDPPTVLTRQPLEVRHETDAQVFFLDYNHPELQPVWYAEAEGDFIPEESGLYDFGLCV
RGTGKLYVDGNLLVNNADVQRPGPSFLGSGTMEETGTLDLVAGRSYRVQVQWGCAKTAKF
KIPGVVDFGHGGFRFGACKQLSPQKGIEQAVKLAASVDQVILVAGLSAEWESEGEDRTSM
RLPPHTDELISRVLEANPDTVVVVQSGTPVEMPWIDQAKAVLHAWYGGNETGNGLADVIF
GDVNPSGKLPLTFPRRLKDNPTYFNFRSEGGRILYGEDVYVGYRFYDEAAIEPLFPFGHG
LSYTTFALSDLCLEWNADNNVHVRCKVRNTGTKAGAEVVQVYVAPVQAPLKRPQKELKEF
RKIRLDPNAEEVVKIPLDLVRATSFWDEKASAWCSHSGTYRILVGTSSRGHFLEASVEVA
ETTFWSGV

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	49	262	2e-67	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.90e-91	2	829	17	755	beta-glucosidase BglX.
224389	BglX	2.14e-77	43	383	48	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.43e-59	331	723	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	3.00e-47	2	809	41	754	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	5.63e-43	52	296	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK49185.1|GH3	0.0	10	848	9	846
BCS12335.1|GH3	0.0	10	848	9	846
BCS00565.1|GH3	0.0	10	848	9	846
QMW48789.1|GH3	0.0	1	847	1	847
UDD66060.1|GH3	0.0	1	847	1	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.57e-265	18	848	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.40e-259	22	848	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.38e-154	22	842	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.37e-117	27	829	9	653	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.96e-107	23	841	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BB53|BGLI_EMENI	0.0	22	848	5	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|B0Y8M8|BGLJ_ASPFC	0.0	23	848	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q4WLY1|BGLJ_ASPFU	0.0	23	848	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B8NDE2|BGLI_ASPFN	0.0	22	848	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	0.0	18	848	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_36871-t33_1-p1.