CAZyme Information: ASPACDRAFT_36855-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_36855-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: carbohydrate-binding module family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830		86883.34	4.6215

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878991:202911-205798(+)

Full Sequence      

MARSSLALLCAALLGKVADAAASQAYTWKNVVTGGGGGFTPGIVFNPSAKGVAYARTDIG
GAYRLNSDDTWTPLMDWVGNDTWHDWGIDALATDPVDTDRLYVAVGMYTNEWDPNVGSIL
RSTDQGDTWTETKLPFKVGGNMPGRGMGERLAVDPNKNSILYFGARSGHGLWKSTDYGAT
WSNVTSFTWTGTYFQDSSSTYTSDPVGIAWVTFDSTSGSSGSATPRIFVGVADAGKSVFK
SEDAGATWAWVSGEPQYGFLPHKGVLSPAEKTLYISYANGAGPYDGTNGTVHKYNITSGV
WTDISPTSLASTYYGYGGLSVDLQVPGTLMVAALNCWWPDELIWRSTDSGATWSPIWEWN
GYPSINYYYSYDISNAPWIQDTTSTDQFPVRVGWMVEALAIDPFDSNHWLYGTGLTVYGG
HDLTNWDSKHNVTVKSLAVGIEEMAVLGLITPPGGPALLSAVGDDGGFYHADLDAAPNQA
FHTPTYGTTNGIDYAGNKPSNIVRSGASDDYPTLALSSNFGSTWYADYAASTSTGTGAVA
LSADGDTVLLMSSTSGALVSKSQGTLTAVSSLPSGAVIASDKSNNTVFYGGSAGAIYVSK
NTATSFTKTVTLGSSTTVNAIRAHPSIAGDVWASTDKGFWHSTDYGSTFTQIGSGVTAGW
SFGFGKASSTSSYVVIYGFFTIDGAAGLFKSEDAGTNWQLISDASHGFGSASANVVNGDL
QTYGRVFVGTNGRGIFYGNPSGSLPAATATATATATTSKTSTTVSTTSTTTTTTKTTSTT
TTTSSGSTATASAYAQCGGSGWTGATVCVSGYKCTYSNDFYSQCKSVVSS

Enzyme Prediction     

EC	3.2.1.151:27	3.2.1.150:4	3.2.1.151:5	3.2.1.151:27	3.2.1.150:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH74	74	186	8.1e-26	0.4678111587982833

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	1.96e-13	794	824	3	33	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.18e-12	794	821	2	29	Fungal cellulose binding domain.
406353	Sortilin-Vps10	3.11e-06	88	201	25	133	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
214740	VPS10	1.41e-05	115	200	53	135	VPS10 domain.
271234	Sialidase_non-viral	3.98e-04	44	248	95	293	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAA29031.1|CBM1|GH74	0.0	1	824	1	853
ACE14921.1|GH74	0.0	21	729	1	709
ACS09151.1|GH74	0.0	21	729	1	709
AAK77227.1|CBM1|GH74|3.2.1.151	0.0	1	827	1	849
CAK43558.1|CBM1|GH74	0.0	1	823	1	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGL_A	6.00e-220	23	740	3	746	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, D60A mutant in complex with XXLG and XGXXLG xyloglucan [Paenibacillus odorifer]
6MGJ_A	9.86e-216	23	740	3	746	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_E Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_F Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_G Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_H Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGK_A Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer]
6P2N_A	1.84e-213	21	740	1	747	Crystal structure of Paenibacillus graminis GH74 (PgGH74) [Paenibacillus graminis]
4LGN_A	1.24e-208	21	743	2	738	The structure of Acidothermus cellulolyticus family 74 glycoside hydrolase [Acidothermus cellulolyticus 11B]
6P2O_A	1.11e-203	24	741	1	727	Crystal structure of Streptomyces rapamycinicus GH74 in complex with xyloglucan fragments XLLG and XXXG [Streptomyces rapamycinicus NRRL 5491],6P2O_B Crystal structure of Streptomyces rapamycinicus GH74 in complex with xyloglucan fragments XLLG and XXXG [Streptomyces rapamycinicus NRRL 5491]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7Z9M8|XG74_HYPJQ	5.84e-262	11	824	8	837	Xyloglucanase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cel74a PE=1 SV=1
sp|Q3MUH7|XG74_PAESP	9.96e-240	12	742	24	768	Xyloglucanase OS=Paenibacillus sp. OX=58172 GN=xeg74 PE=1 SV=1
sp|A3DFA0|XG74_ACET2	7.86e-196	19	748	31	766	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xghA PE=3 SV=1
sp|Q70DK5|XG74_ACETH	3.12e-195	19	748	31	766	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus OX=1515 GN=xghA PE=1 SV=1
sp|Q8J0D2|CBHRE_GEOS1	7.39e-85	20	737	21	782	Oligoxyloglucan reducing end-specific cellobiohydrolase OS=Geotrichum sp. (strain M128) OX=203496 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999730	CS pos: 20-21. Pr: 0.9823

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_36855-t33_1-p1.