CAZyme Information: ASPACDRAFT_35606-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_35606-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	KV878988|CGC4	45078.02	6.4438

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878988:399871-401131(+)

Full Sequence      

MIRSGSGCQWFTRRRLQLSLAFAVVIACIYTIIPASSRQDGYANTNNEPPQHHKLPFTSP
SYARSLSARELISLPRSSDLVSIPKLIHQTWFPAGSNMSDNAQFWVQTMRAQNSDWEYVL
WDDETNRLLVETHFPWFLQDYLRLPKEILRADVVRNLYMFLFGGMYADVDTEALRPVDSL
FAGHDTPLRAAHSSLLGSWTGKVKVASPHAASTLTQRAFLGHMAHQAGLDGPAAVPNGWM
ASPPGHPFWLLPVIHVIENPNGSEDGSVESLTGPTALSFLLHRYYEDFEGDEKTVRKHVC
RKVRRWSPGWEMYCGPEGHEDDVPELQRKGSGAPVVVQDKMVILPRQQIYPYSWEDDKQL
SACLAAFENPQFDPEACKRAIDVEAWPSYFITYCTHSW

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_35606-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	104	180	7.1e-16	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.86e-22	75	284	75	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.80e-12	99	180	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10897.1|GT32	5.12e-179	5	398	9	371
BCR98563.1|GT32	5.12e-179	5	398	9	371
QRD92713.1|GT32	8.39e-147	7	398	8	362
QMW36295.1|GT32	8.39e-147	7	398	8	362
QMW48351.1|GT32	4.81e-146	7	398	8	362

PDB Hits     

ASPACDRAFT_35606-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	3.10e-16	77	180	51	152	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.37e-14	60	284	59	243	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	8.03e-11	79	284	60	229	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q5A4E3|OCH1_CANAL	4.85e-09	14	194	12	215	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.75e-06	83	179	96	198	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.942725	0.057309

TMHMM  Annotations     

Start	End
16	33