CAZyme Information: ASPACDRAFT_34742-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_34742-t33_1-p1
• CAZy Family: GH27
• CAZyme Description: glycoside hydrolase family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440		46020.35	4.3087

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878986:264624-266140(+)

Full Sequence      

MRGLFLLALGAIPALVSGQLSGSVGPLTSASTKGATKTCNILSYGAVADNSTDVGPAITS
AWAACKSGGLVYIPSGNYALNTWVTLTGGSATAIQLDGIIYRTGTASGNMIAVTDTTDFE
LFSSTSKGAVQGFGYVYHAEGTYGARILRLTDVTHFSVHDIILVDAPAFHFTMDTCSDGE
VYNMAIRGGNEGGLDGIDVWGSNIWVHDVEVTNKDECVTVKSPANNILVESIYCNWSGGC
AMGSLGADTDVTDIVYRNVYTWSSNQMYMIKSNGGSGTVSNVLLENFIGHGNAYSLDIDG
YWSSMTAVDGDGVQLNNITVKNWKGTEANGATRPPIRVVCSDTAPCTDLTLEDIAIWTES
GSSELYLCRSAYGSGYCLKDSSSHTSYTTTSTVTAAPSGYSATTMAADLTTAFGLTASIP
IPTIPTSFYPGLTPYSALAG

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	62	371	2.7e-48	0.963076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215540	PLN03010	1.28e-22	40	373	48	391	polygalacturonase
177865	PLN02218	8.71e-19	35	356	64	408	polygalacturonase ADPG
395231	Glyco_hydro_28	1.86e-18	146	356	86	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
165802	PLN02155	1.96e-18	35	373	24	380	polygalacturonase
215120	PLN02188	2.49e-16	33	361	31	379	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAA64367.1|GH28|3.2.1.171	0.0	1	440	1	440
AAB35485.1|GH28|3.2.1.171	0.0	1	440	1	440
CAB58937.1|GH28|3.2.1.171	0.0	1	440	1	440
CAA58507.2|GH28|3.2.1.171	0.0	1	440	1	440
CAB58938.1|GH28|3.2.1.171	0.0	1	440	1	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	5.08e-312	19	440	1	422	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	4.15e-21	49	368	26	371	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00001|RHGA_ASPAC	0.0	1	440	1	440	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|A2QYE5|RHGA_ASPNC	2.00e-259	1	439	1	440	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	2.71e-257	1	439	1	440	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|A2R3G4|RHGB_ASPNC	8.20e-237	9	438	12	443	Probable rhamnogalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgB PE=3 SV=1
sp|P87161|RHGB_ASPNG	3.32e-236	9	438	12	443	Rhamnogalacturonase B OS=Aspergillus niger OX=5061 GN=rhgB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999720	CS pos: 18-19. Pr: 0.9752

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_34742-t33_1-p1.