CAZyme Information: ASPACDRAFT_31966-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_31966-t33_1-p1
• CAZy Family: GH18
• CAZyme Description: glycoside hydrolase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598	KV878981|CGC5	67550.41	6.3990

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878981:61230-63026(+)

Full Sequence      

MLKPRATATRELVSLDGIWNFALGDDQVGTSCVQPLSPELQVPVPASYNDIFIDPRIRDH
VGWVYYQRSVRVPRGWAGEKYFLRVDAATHHGRVFVDSQLVAEHSGGYTPFETDISHLVA
AGAEFCLTIAVSNILTNATIPPGKVETLANGKRKQQYQHDFYNYAGLARSVWLYSVPQVH
IQDVTIVTSTSQTSGIVDYQVTANRMIPENQFHLSLLDENGQVVAQSNGPQGRIRVESAH
LWQPGAAYLYQLQVELLRGDDRKELLDTYTIATGIRSVEVSGMQFLINGKPFYFTGFGKH
EDTAIRGKGHDPAYMVHDFQLMKWLGANSFRTSHYPYAEEVLEYADRHGIVVIDETAAVG
LNLAIVAGIHGTKAPPTFSPDTINEHTQMAHKNALQELISRDKNHPCVVLWMIANEPASG
EVGAVEYFKPLVKFTRELDPSRPICFANMAFNPVNRDLITDMFDVICLNRYFGWYKHTGE
LDMAEEALYEELSGWQDKFGKPMIITEYGADSLAGLHAVNDVPWSEEYQSRLLEMYHRVH
DRLDAVVGEHVWNFADFQTTSQIFRVNGNKKGIFTRDRQPKAAARVLRERWTKPFLTR

Enzyme Prediction     

EC	3.2.1.31:89

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	7	585	1.6e-100	0.6063829787234043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	0.0	1	593	1	594	beta-D-glucuronidase; Provisional
225789	LacZ	5.26e-125	1	593	1	597	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	2.26e-101	278	593	1	299	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	1.37e-38	66	556	113	547	cryptic beta-D-galactosidase subunit alpha; Reviewed
236548	lacZ	8.58e-34	166	444	208	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK93312.1|GH2	1.14e-300	1	592	1	593
AFM77719.1|GH2	3.32e-299	1	594	1	595
QKD50402.1|GH2	3.16e-290	1	593	1	594
BCR84878.1|GH2	8.22e-286	2	595	41	637
ABU68712.1|GH2|3.2.1.31	2.62e-283	1	592	1	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C70_A	1.21e-284	1	592	9	598	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	2.44e-283	1	592	34	623	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6LEJ_B	7.83e-225	1	592	1	589	Chain B, Beta-D-glucuronidase [Escherichia coli]
6LEG_A	8.11e-225	1	592	2	590	Chain A, Beta-D-glucuronidase [Escherichia coli],6LEG_B Chain B, Beta-D-glucuronidase [Escherichia coli],6LEG_C Chain C, Beta-D-glucuronidase [Escherichia coli],6LEG_D Chain D, Beta-D-glucuronidase [Escherichia coli],6LEL_A Chain A, Beta-D-glucuronidase [Escherichia coli],6LEL_B Chain B, Beta-D-glucuronidase [Escherichia coli]
3K46_A	8.39e-225	1	592	3	591	Crystal structure of full-length E. coli beta-glucuronidase [Escherichia coli K-12],3K46_B Crystal structure of full-length E. coli beta-glucuronidase [Escherichia coli K-12],3K4D_A Crystal structure of E. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound [Escherichia coli K-12],3K4D_B Crystal structure of E. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound [Escherichia coli K-12],6LEM_A Chain A, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P05804|BGLR_ECOLI	4.03e-224	1	592	1	589	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
sp|O97524|BGLR_FELCA	1.45e-168	1	593	27	627	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|O18835|BGLR_CANLF	2.31e-167	1	593	27	627	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|Q4FAT7|BGLR_PIG	1.53e-165	1	593	28	628	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1
sp|Q5R5N6|BGLR_PONAB	4.19e-165	1	593	27	628	Beta-glucuronidase OS=Pongo abelii OX=9601 GN=GUSB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000009

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_31966-t33_1-p1.