CAZyme Information: ASPACDRAFT_30614-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_30614-t33_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	KV878979|CGC2	45042.02	5.3985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878979:44667-45863(-)

Full Sequence      

MQANTPLSGVFLPRHLRRVAPLFFSAFVLVFYLSLTGTFGGVNGSLSGPTARYKQFPRKI
WQSWKVNPLAFEPRDLLVARSWPEKNPRHRYEVLTDENDLYYVETHYGPEGLNRPDIVEV
YRSLNARIIKADLLRYLIMYVDGGIWADIDVEALRPLDRFIPERFTEDEMDLVIGVEIDE
PEFNDHAILGQKSQSFCQWTFMSKPRHPVMMRLVDNILAWLHELSVQQGKPIGELELDFD
DVISGTGPSAFTSAVLAEMSIRLGHEVSWNTFHNIPESKLVGGILVLTVEAFAAGQGHSD
SGNHNARTALVKHHYHASNWPSNHPRFSHPVYGEVEKCNWNKECVRAWDENTAAFAALPP
DEQERQIALKQANDAAETELQLNLGMDLGLDLGLNLGQ

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_30614-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	79	163	1.8e-18	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.40e-22	56	282	82	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.15e-11	80	163	9	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17076.1|GT32	1.45e-219	1	380	10	397
CAK96510.1|GT32	2.35e-219	1	380	1	391
BCS05523.1|GT32	5.53e-218	1	380	111	498
QMW40889.1|GT32	1.76e-212	7	381	1	376
BAE58544.1|GT32	1.76e-212	7	381	1	376

PDB Hits     

ASPACDRAFT_30614-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.68e-34	53	320	139	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	7.92e-33	49	313	92	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	9.93e-28	45	292	119	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	6.50e-23	45	235	85	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	5.75e-07	57	161	58	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000003

TMHMM  Annotations     

Start	End
20	42