CAZyme Information: ASPACDRAFT_26621-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_26621-t33_1-p1
• CAZy Family: GH15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	KV878974|CGC14	66513.39	4.9029

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878974:1988769-1990655(+)

Full Sequence      

MTAAKSYDYVVVGAGTSGLVLASRLTEDAGVNVLLIEAGANRMGDPRIETPGFLSTLYGN
PDFDWDYMSEPQIHVNNRQIAQPRGRVVGGTSAMNFSVVMYPSESNFAAWKSLGNEGWGP
EDMAPYLRKFHTYTPPSEATSTLLSLERYMSPENQGTSGPVPITLPDVYGPFNQAWDEAF
ARLGWRTDADPIAGRKIGAFTAPLTVDGKTGQRGYAAAYYSPEVAQRPNLDLLTETMVER
VLLTEVDGEVVATGVQVRAKDGERQEIPAAREVILCAGSLNTPQLLELSGIGQRELLEKH
DIPVILDRPGVGENLQDHCLASINFEVADDQVSGDIMRDPNVVQSLIQLYEQTRGGPLSG
MPISMAYLPLVDHDGQLSREKVHELLDQHLDQEAADLPPAQQKQFALQRELLQAGHNASS
QYMLMPIQTHMLPGVTTLADVLAKSLPGNYLTVMVLHNHPFSRGSVHIRSRNVEDKPVFD
PNYLSHPLDLEILARHVQFLDQIVATEPLASMLKPQSRIPQGVVDYSNLDKTKEVVKERL
YTCFHPAGTCAMMPAELGGVVDSQLKIHGTRNLRVVDASIFPLEPAGNIQATVYAVAERA
ADLIRGH

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_26621-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	605	8.7e-181	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.23e-106	2	606	1	533	choline dehydrogenase; Validated
225186	BetA	3.13e-106	1	607	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	8.24e-40	460	600	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.98e-33	75	318	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.26e-32	6	593	55	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96255.1|AA3_2	0.0	1	606	1	607
BCR96633.1|AA3_2	0.0	1	606	1	607
UDD56791.1|AA3_2	4.27e-303	5	605	6	607
QMW28733.1|AA3_2	3.49e-302	5	605	6	607
QRD83267.1|AA3_2	3.49e-302	5	605	6	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.42e-77	6	605	5	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.37e-75	5	605	4	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	4.54e-67	7	605	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.54e-66	7	605	3	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5ZU3_A	4.06e-58	2	605	2	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.28e-107	7	605	14	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.28e-107	7	605	14	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	2.66e-102	5	604	12	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.36e-81	6	605	39	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	7.04e-80	5	607	45	618	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999804	0.000214

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_26621-t33_1-p1.