CAZyme Information: ASPACDRAFT_26239-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_26239-t33_1-p1
• CAZy Family: GH142
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	KV878974|CGC10	40031.35	4.7911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878974:269373-270455(-)

Full Sequence      

MILSLSRPVTLALSTLLLLNFYLFHRVLHQPVVTSTFAVNTTPAQQQQREQQEQDQQQQA
FLSPTPTPSPEPTSATQPTWTTLSVSAATPTIAPTSTAFPMKLWQKSGPKGVSPDIQTYI
QSWHALNPSLRHEILSDDSALAYVEETFRDDWPEVADLYQQIQVPIIRADLLRLLILYAD
GGIWSDLDVTCEAPIAEWIPDVFVKDDGNIWVKEQVNVVVGLEFDGWQFASWTMMAKPRL
NHFEAAIEYVMHQMEGIAQSHNVSLSGVTMEMIPDVVDASGPQAITVALLRSLSHTLGKT
VDRSNITSLHEPRLLGDVLVLPQAAYAALQGGYPQDQGPYLVSHHYAGSWKNVQGGEQRR

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_26239-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	116	200	1.4e-19	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.81e-19	92	238	75	231	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.87e-15	117	201	5	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30122.1|GT32	4.94e-108	99	358	111	364
CAK40793.1|GT32	8.69e-108	5	358	2	351
EAA62114.1|GT32	4.93e-102	96	358	109	365
QQK40626.1|GT32	2.95e-100	98	359	92	343
CAP80736.1|GT32	1.00e-95	98	357	92	341

PDB Hits     

ASPACDRAFT_26239-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.09e-25	100	352	143	395	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.76e-17	96	352	96	377	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	5.22e-16	99	359	130	396	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	8.49e-11	100	238	97	270	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000009

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_26239-t33_1-p1.