CAZyme Information: ASPACDRAFT_25930-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_25930-t33_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: glycoside hydrolase family 93 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	KV878974|CGC17	38534.58	6.4989

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878974:490134-491195(+)

Full Sequence      

MGYPGQGHGHSHPRPNRHVHHDQRALSNGNGGTYPRLARLSDGSLLSSFTRFPGDGSRVL
VVARSTDGHNFEDIGEVTRGTGDTDNLFLLEVAPSVVLGAFRNHDHDPSGRVTHFRITVC
RSHDGGRTWQFASQAAEKPGADGLGIWEPFMRMGSGGEVQLTYSQEFAQNNQCTMLVTST
DQGSTWSEPRCLHGKDDNRRDGMNGIARTFDADLGKEVLVMVFETNTKGPMQIEALISDN
DGDSWGRRHVVYSPHDGHRHNAGAPQIASFADGSLAVVFMTDEDHDKVDWVKNASIKAVF
ALPPRGGEIHWDQTSTSICADSSHWPGVFALDGHTLLATYECKGPKARAISLQ

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_25930-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	31	297	1.1e-64	0.9055374592833876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	6.51e-11	102	288	35	225	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	4.35e-07	113	286	170	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	0.002	27	129	194	293	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	0.009	39	197	152	304	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99274.1|GH93	3.74e-147	16	353	43	376
BCS11580.1|GH93	3.74e-147	16	353	43	376
EAA62412.1|GH93	5.79e-144	17	353	39	367
QMW42642.1|GH93	6.18e-144	1	352	40	378
QMW30589.1|GH93	6.18e-144	1	352	40	378

PDB Hits     

ASPACDRAFT_25930-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPACDRAFT_25930-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_25930-t33_1-p1.