CAZyme Information: ASPACDRAFT_23593-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_23593-t33_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
943	KV878972|CGC4	102542.05	4.8877

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878972:500010-502994(-)

Full Sequence      

MNQYYPTSLEREGRTSLQPYPTVTNVPHNLNDLLHDLESPADLFDLLLPDFEDSDSDSPA
ADPTSTEDSPLHRPTGHRPTPTPTDIDDNDDADDESEDLDDNSTSVSLTDKPSTATPTTT
DSDTEPSEISNAATSTPSTVLPSKLCLGSYVACFTQMSGGQDVFVPLATGAIPPVVTSRG
DHPVPKKGIENVNTPIETNKFYSGIFLGSQTNATFTHPYAVAWAKGSGNAQSYGMAVWHN
EANVVANGPTNSKIPGNPISYYVNPIGIQHLILSATELKASTVLTGENLLPFSADAVLKP
DSGSSQRLTVPLVQGMGFVTGLYTNLQPLIQTGVFFRQVVTAASPRVGIFKYKATMEDGS
IWLIYATPQDGKDPNFQLESNTNFRGPAGWSGFVQITKNPGGDSGEKLLDGSAGVFALEA
AISGTVNARTGTYQLSWAKSGTKTQDTPLMMYALPHHVESFDATTKSRMTSINLRTTTKG
NAVAVVGETWTMVEPDLPTDMGFAPWSASSGNVNSISAAAQKVILAVAPTELNQSIDAQT
NLNSMYYSGKALSKFATLVYTVNKLGGDPALAASALQNLKTAFSRFSTNQQQFPLVYDTV
WKGVVSSASYGGDSGADFGNTYYNDHHFHYGYFIHAAAIIGSLDPTWLSSNRDWVNMLVR
DAGNSAANDPYFPFSRAFDWFNGHSWAKGLFESFDGKDQESTSEDTMFAYALKMWGKTIS
DPSLEARGNLMLGILKRSLHNYFLLESDNKNQPANFIANKVTGILFENKVDHTTYFGANL
EYIQGYVRASRSTINSSRIHMLPLMPFSGFTRRQNFVREEWNALFASTASTPASNVVGGW
KGVLYANLALIDPATSWDFFAQSNFDYSWIDGGASRTWYLAYAAGKFDTLGSLKQFSTDH
IDSFGRSLVRERSVLVENVIHIFSLFMASTSVLFGRHEGDVYA

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	183	882	3.1e-220	0.9887459807073955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	515	880	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	127	885	6	754	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.16e-148	182	508	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR95538.1|GH81	0.0	152	885	215	935
BCS08078.1|GH81	0.0	3	885	9	890
CAK43675.1|GH81	0.0	134	887	213	953
EAA66571.1|GH81	0.0	4	894	57	902
CBF89420.1|GH81|3.2.1.39	0.0	4	885	57	900

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.68e-97	158	857	3	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.92e-97	158	857	28	719	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	8.58e-95	158	857	3	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	4.30e-24	531	863	326	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5UPI_A	1.14e-15	546	778	361	592	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPM_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPN_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPO_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.70e-314	160	889	190	905	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	5.21e-180	161	885	1	701	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.99e-165	182	885	66	736	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	2.51e-160	155	885	420	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	4.00e-158	173	885	411	1111	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_23593-t33_1-p1.