CAZyme Information: ASPACDRAFT_23289-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_23289-t33_1-p1
• CAZy Family: GH13
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580	KV878972|CGC1	64266.70	6.4018

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878972:2000225-2002296(+)

Full Sequence      

MEDREFYDYIICGGGTSGCVVAGRLAENPQVRILVIEAGQHNKDLESVHMAGAWSTNFDK
ETDWNIVTRPMSGVDDRQVKLSRGRFLGGSSGCNGTLCIRGCKQDYDDWGLDGWSGQEFF
QYMRKTFHSKPWFKANHEYHGQSGPLHIEPHDLAPISNLIMDSFVSQGLPLDHDMFTTGE
TPHGCGHVPRTVHKGIRTTSGDFITNGYLRSNVTIMTETTVDKVLLGQGSEGLKAEGVVV
ITPDGPRSIYAKREIIISGGAYCSPAILMRSGIGSKEELNKHDIECKVDLPGVGQNLLDH
MIVFMFYETEKPGLTNDHLVHHGDSFEKSYALWKEKKEGFLSTFPFGCFAFARLDDRLKD
EPLWRDAPREPGRDPMGLTPKQPNIEFFTTECYGGPKQYDQFPIDHKHAFSIIAELFSPR
SRGSVTLSSKNPLENPIVDCNYLSDPLDLLVLTEACQFANEIITKGAGTKDIVKGSWPPN
LAHHTYTKREEWIPYVKEHGTTCYHAAGTCAMGKDGDPNAVLDHKLRVRGVSGLRVADCS
VMPTLHGGHTQMPAYGIGEKCADLIKETWSTPSLGGVSRL

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_23289-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	567	3.8e-159	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.64e-105	1	566	1	532	choline dehydrogenase; Validated
225186	BetA	1.10e-94	7	567	8	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.52e-61	8	565	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	8.45e-40	419	561	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.05e-31	74	302	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07163.1|AA3_2	0.0	7	574	5	574
UDD65288.1|AA3_2	0.0	4	574	6	579
QMW48130.1|AA3_2	0.0	4	574	6	579
QMW36070.1|AA3_2	0.0	4	574	6	579
CAK49001.1|AA3_2	0.0	1	580	1	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	3.36e-76	3	566	3	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.70e-76	3	566	3	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	6.57e-76	3	566	3	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	2.06e-62	7	570	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	9.72e-58	7	566	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	2.66e-77	1	565	1	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	7.50e-75	7	565	5	530	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	1.70e-74	4	565	2	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	6.49e-74	4	565	2	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|P18172|DHGL_DROPS	2.15e-70	7	569	65	608	Glucose dehydrogenase [FAD, quinone] OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Gld PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_23289-t33_1-p1.