CAZyme Information: ASPACDRAFT_21823-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_21823-t33_1-p1
• CAZy Family: PL42
• CAZyme Description: glycosyltransferase family 31 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		53020.29	5.5666

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878971:2373549-2374952(-)

Full Sequence      

MWRRKLLRFVVAACLVTSFTIFLWPEIEPHHEITTQTISNITVSSEVECEPDFDALQRLN
VRKLSQYVRREIVASPSSSDVVPIAQKLEVPLFEKIHKDHRFAEDSMHQDDCLMPRPVSV
SVPAILPRADASHIDFGVATTLERLNESLDAFTHWAGHTNARILALIEPDARINEVLTKA
ENLGVNLSVTESTEEYQHRYFSLVPHLAKNLRPQTRWTCVIDDDTFFPSMTALVQALSKY
DDSAQTYVGGLSEAMPQVGIFGLMGFGGAGVFMSRPLIEQIGRKEVYEDCQKMESTGDRK
ISLCIYQYSDAHLTIDHRLRQIDMRGDVSGFFEAARPPPLSVHHWKSWFNADMAKLGVVS
EVCGDSCLLRKWHFGDGWILTNGFSIVKYSNDVPTGDKSMELTWAGDNGAVFESFLHELG
PLRPKDEGKISYIHEDAIIDGNQVRQWYIRRDPELGDKVLELIWRKE

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_21823-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	5.87e-13	213	344	209	341	hypothetical protein; Provisional
367085	Fringe	8.36e-06	169	278	43	156	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	4.24e-05	264	344	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96997.1|GT31	4.95e-254	3	465	15	477
BCS09474.1|GT31	4.95e-254	3	465	15	477
CAK44690.1|GT31	8.05e-244	1	448	1	448
BAE58287.1|GT31	1.82e-234	2	467	18	485
UDD56605.1|GT31	1.82e-234	2	467	18	485

PDB Hits     

ASPACDRAFT_21823-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPACDRAFT_21823-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.958358	0.041665

TMHMM  Annotations     

Start	End
7	24