CAZyme Information: ASPACDRAFT_20898-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_20898-t33_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	KV878970|CGC17	54228.83	4.9862

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878970:440068-441880(-)

Full Sequence      

MGSAGASTLPQDFLWGFATASYQIEGAVTEDGRGPSIWDTFCKIPGKIADGSNGDVACDS
YHRVDEDIALLKQCGAKAYRFSISWSRIIPLGGRNDPINQKGLDHYSAFIDRLHAAGIVP
LVTLYHWDLPDELDKRYGGLLNKEEFVADFTHYARVLFAAFGGRVKHWITFNEPWCSAVL
GYNVGQFAPGHTSDRSKSSVGDGSREPWIVGHNLLVAHGAAVKVYREEFKERDGGEIGIT
LNGDWAEPWDPANPADVEACTRKIEFAISWFADPIYHGKYPDSMVQQLGDRLPAWSAEDR
ALVLGSNDFYGMNHYCANYIKAKTGEPDPTDTAGNLEILLQNKAGEWIGPETQSAWLRPC
AIGFRKLLKWLSDRYGQPKIYVTENGTSLKGENDLPVEQLLQDEFRVQYFRDYIAAMADA
YTLDGVNVRAYMAWSLMDNFEWAEGYETRFGVTYVDYENGQKRLPKESAKQIGKIFEQYI
KKE

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	478	1.8e-163	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274539	BGL	0.0	10	470	1	424	beta-galactosidase.
395176	Glyco_hydro_1	0.0	8	470	4	442	Glycosyl hydrolase family 1.
225343	BglB	3.35e-147	7	477	2	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	9.42e-117	9	469	28	473	beta-glucosidase
215455	PLN02849	4.14e-114	7	469	28	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12207.1|GH1	0.0	1	482	1	482
BCS00431.1|GH1	0.0	1	482	1	482
QEV81508.1|GH1	0.0	1	482	1	482
CAK47813.1|GH1	0.0	1	482	1	482
QRD82378.1|GH1	0.0	1	482	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	2.22e-274	8	483	25	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	2.06e-243	9	483	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5BWF_A	7.87e-241	5	483	18	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	2.27e-240	9	483	3	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
3AHY_A	5.02e-234	9	480	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	6.78e-192	3	480	5	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	6.15e-181	6	480	3	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9M1D0|BGL16_ARATH	3.82e-141	10	476	36	500	Beta-glucosidase 16 OS=Arabidopsis thaliana OX=3702 GN=BGLU16 PE=2 SV=1
sp|Q0DA21|BGL25_ORYSJ	2.02e-140	10	478	26	496	Beta-glucosidase 25 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU25 PE=2 SV=2
sp|Q5Z9Z0|BGL24_ORYSJ	1.26e-139	7	469	31	495	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_20898-t33_1-p1.