CAZyme Information: ASPACDRAFT_1903391-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1903391-t33_1-p1
• CAZy Family: GH114
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599	KV878980|CGC8	64687.15	5.7959

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878980:769600-771725(-)

Full Sequence      

MATAYDFVIIGGGTAGLVVASRLSEDPSLSVLVLEAGADMTADPRVNIPIFYAALLGSDA
DWKFQSSPQPGLNGRVLGLNQGKTLGGSSSLNAHVFVPPFKGAVDAWEELGNPGWNWTML
KDYFSKAYNCPTVAQNAKGNLAIEDWPGMNEAKGPIQTSFGNETHPIRRAWAELFRSSGQ
CNAGDPFTHSSVGSFSCLASIDSQGKRSNSSSAYYKLAELRQNLHVLTNSFVERVLFDES
KPPRAIGVQYNLDGVSKTVQAKSEVILAAGAFQSPKILQLSGVGRAELLEQHGIDLVADL
PGVGQNLQDHMISYTAFHAKPELETKDSLVRQEPEAIGQATQEYAATQSGPLASLGVHTY
AYLPLPKPDRSALQALFTSDAPENPQHKTTQAYYDIAKTTVLDPKQPSAAYLSALGQTNY
SKDLKDGTIPAASPGKFVTLGVMLSQPLSRGSVHITCNNPEMPPIIDPGYLSNPLDLEVM
ARHMLRIKKLAESPQLGALLEQPLKFRDPDADFQGDLDAAKRYARDNLVSMWHFAGTCSM
LPREKDGVVDPNLKVYGVEGLRVVDASAIPLVSTANLQATVYAFAERAVDLIKQDRESK

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_1903391-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	595	4.8e-176	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.13e-107	1	593	2	532	choline dehydrogenase; Validated
225186	BetA	5.06e-98	1	596	4	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.12e-39	447	588	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.56e-31	73	312	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.45e-25	3	581	54	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48092.1|AA3_2	0.0	1	599	1	599
QMW36031.1|AA3_2	0.0	1	599	1	599
QRD93013.1|AA3_2	0.0	1	599	1	599
BCS16880.1|AA3_2	0.0	3	599	4	600
BCS05325.1|AA3_2	0.0	3	599	4	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	4.85e-75	3	598	4	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	4.38e-74	5	596	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.49e-73	5	596	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	9.99e-67	5	595	6	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6XUT_A	1.79e-62	5	593	17	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	1.52e-88	3	595	12	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.52e-88	3	595	12	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	4.58e-86	3	595	12	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.92e-82	5	592	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.92e-82	5	592	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999801	0.000255

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1903391-t33_1-p1.