CAZyme Information: ASPACDRAFT_1901759-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1901759-t33_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	KV878978|CGC3	57879.90	4.2096

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878978:445301-446950(-)

Full Sequence      

MVDSFSIYKTALLLSMLATSNAQQVGTYTAETHPSLTWQTCSGSGSCTTTSGSVVIDANW
RWVHEVGGYTNCYSGNTWDSSICSTDTTCASECALEGATYESTYGVTTSGSSLRLNFVTT
SSQKNIGSRLYLLADDSTYETFKLLNREFTFDVDVSNLPCGLNGALYFVSMDADGGVSRF
PTNKAGAKYGTGYCDSQCPRDLKFIDGEANIEGWEPSSTDVNAGTGNHGSCCPEMDIWEA
NSVSSAFTAHPCDSVQQTMCTGDTCGGTYSDTTDRYSGTCDPDGCDFNPYRLGNTDFYGL
GKTVDTSKPFTVVTQFITNDGTDTGTLTEIRRLYVQNGVVIGNGPSTYTAASGNSITESF
CKAEKTLFGDTNVFDTHGGLSAMGDALGDGMVLVLSLWDDHAADMLWLDSDYPTTSSATS
PGVARGSCPTTTGNATYVEANYPNSYVTYSNIKFGTLNSTYSGSTSGGSSSSSTTLTTKA
STSTTSSKTSTTTTSSKTTTTTSKTSTTSSSSTNVAQLYGQCGGQGWTGPTTCASGTCTK
QNDYYSQCL

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	24	461	2.1e-193	0.9951807228915662

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395677	Glyco_hydro_7	0.0	25	458	1	432	Glycosyl hydrolase family 7.
153432	GH7_CBH_EG	0.0	30	455	1	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
395595	CBM_1	3.68e-12	518	545	1	29	Fungal cellulose binding domain.
197593	fCBD	2.25e-11	518	549	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAA25183.1|CBM1|GH7|3.2.1.176|3.2.1.132	0.0	1	549	1	540
AHI87690.1|GH7	2.06e-309	23	467	2	446
QEQ56122.1|CBM1|GH7	8.96e-283	2	549	1	536
BCR93402.1|CBM1|GH7	1.48e-281	2	549	1	536
BCS06046.1|CBM1|GH7	1.48e-281	2	549	1	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V1Z_A	3.81e-247	24	462	2	438	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]
1Q9H_A	2.75e-239	24	464	2	437	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]
4XEB_A	4.97e-218	24	463	2	435	The structure of P. funicolosum Cel7A [Talaromyces funiculosus]
4ZZT_A	2.73e-213	24	464	2	438	Geotrichum candidum Cel7A structure complex with thio-linked cellotriose at 1.56A [Geotrichum candidum],4ZZU_A Geotrichum candidum Cel7A structure complex with thio-linked cellotetraose at 1.4A [Geotrichum candidum],4ZZV_A Geotrichum candidum Cel7A apo structure at 1.4A [Geotrichum candidum],4ZZW_A Geotrichum candidum Cel7A structure complex with cellobiose at 1.5A [Geotrichum candidum],5AMP_A Geotrichum candidum Cel7A apo structure at 2.1A [Geotrichum candidum]
4ZZP_A	6.58e-212	24	464	2	439	Dictyostelium purpureum cellobiohydrolase Cel7A apo structure [Dictyostelium purpureum],4ZZP_B Dictyostelium purpureum cellobiohydrolase Cel7A apo structure [Dictyostelium purpureum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59843|CBHB_ASPAC	0.0	1	549	1	540	1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus OX=5053 GN=cbhB PE=2 SV=1
sp|Q9UVS8|CBHB_ASPNG	4.32e-281	2	549	1	536	1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger OX=5061 GN=cbhB PE=2 SV=1
sp|A2QAI7|CBHB_ASPNC	6.14e-281	2	549	1	536	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhB PE=3 SV=1
sp|B0Y8K2|CBHB_ASPFC	7.36e-267	4	549	7	532	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=cbhB PE=3 SV=1
sp|Q4WM08|CBHB_ASPFU	7.36e-267	4	549	7	532	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999720	CS pos: 22-23. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1901759-t33_1-p1.