CAZyme Information: ASPACDRAFT_1892988-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1892988-t33_1-p1
• CAZy Family: GH106
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	KV878970|CGC4	50795.22	9.0448

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878970:1551495-1553050(+)

Full Sequence      

MASMLWVQASRPHRSLLAVFILWKSLLLLLAAFTPGPGYDTSTTLIEWNSDPTKAPLPAL
WKTISTKLTRWDAIYFTHAANRGYIFEQEWAFGYGCNRLIHVLANGCRKLSFLDYAFNES
LVGISISHAAHGLSVIVLYHLVCALFPGAQGRRKVALLAACLHVVSPAGAFLSAPCAESA
YALLSFCGSLLFVKSFASSSDASSSSCQDTLLVLSGVLYGLATTFRSNGLLNGIPLFEEA
VRQLVLLSQQGCSLAKLRRLLAVGTAGVCTGLGFVLPQYIAYQEFCTDREPRAWCRRTLP
SIYSFVQEHYWDNGFLRYWTVSNIPLFGLAGPMLAILLASGWQALNGELGSLVGLGLPSR
RPVEKLRDSPPQARVTDRLLRSLAVPQLVIAVLTFFNHHVQIITRMASGYPLWYVWVACL
LLRGGSATEEGGGWYKRGGSLVVNYMVVYALVQGVLYASFLPPA

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_1892988-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	17	464	1.5e-112	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	8.38e-34	16	464	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.65e-12	70	464	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR97098.1|GT76	1.23e-173	4	464	1	464
BCS09572.1|GT76	1.23e-173	4	464	1	464
QMW44188.1|GT76	8.04e-159	10	464	6	472
QRD83592.1|GT76	2.29e-158	10	464	6	472
QMW32162.1|GT76	2.29e-158	10	464	6	472

PDB Hits     

ASPACDRAFT_1892988-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2GSI6|GPI18_CHAGB	1.69e-100	10	464	16	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	8.90e-100	10	464	8	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.78e-94	7	464	24	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	1.36e-92	10	464	16	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.75e-40	15	464	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000010

TMHMM  Annotations     

Start	End
13	35
124	146
260	282
319	341
441	463