CAZyme Information: ASPACDRAFT_1891375-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1891375-t33_1-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554	KV878987|CGC5	59484.64	5.3784

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878987:466501-468221(-)

Full Sequence      

MHVFWTATTLLASAGALLGAQARPTDSKNHTVQSGYDYIVVGGGPSGIITAERLAEANKT
VLLLERSTAGPTVGTGSNYTLSWNDTLTAIDVPGLSFDVGNFPQWSEYICTDTDGTAACI
LGGGVTVNYMVFVHPPDHDFNDKWPVGWKWANVTAGADRLYARNPGSSVPSADSKLYDQT
LFTTLSTFFNNLNWTATDMSAQRNEKFQTYSHPVWNIKDYKRAGPVRTYLPLALQYPNFS
LRMGALATRVVRHGSLVTGVEIVNVATNQTETVPLAPGGRVVLSSGALHSPRILFNSGIG
PRAQIETAQKSGIAVPPAKEWIHLPVGESLMDHPIFSIVIQTDKDFNELDAAAILNGTAT
SEITAYEEQNDGVLTQGKHRMIFFSSNVASDGHTRYYQGSCTPTAEGEVTITTYMTHGLT
SKGVLGLDADQRTVIEKSPYLQTAGDREAATMFIQSMVDAINAPGSGFQLVEYTNTTAIL
GSLTAGIHYAGTTKMGTDDGRFNGTAVVDTNTKVYGTDNLYIVDGGIHPDLASGNNQATI
MVVAENAVERILAH

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_1891375-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	28	553	1.3e-177	0.9799270072992701

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	5.46e-54	36	554	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.15e-33	37	549	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	8.85e-30	36	552	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.17e-18	403	547	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.15e-12	120	335	26	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW45398.1|AA3_1	7.71e-246	14	553	6	538
QRD84961.1|AA3_1	7.71e-246	14	553	6	538
QMW33361.1|AA3_1	7.71e-246	14	553	6	538
UDD61147.1|AA3_1	3.12e-245	14	553	6	538
GAA84602.1|AA3_1	2.10e-243	11	553	9	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NAA_A	4.23e-90	36	553	3	536	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	4.83e-90	36	553	8	541	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI7_A	7.12e-85	2	553	196	765	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	2.62e-84	36	553	8	544	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	2.85e-82	36	553	230	766	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	4.83e-87	36	553	235	768	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|A8JHB7|FAP_CHLRE	1.62e-22	20	547	36	592	Fatty acid photodecarboxylase, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=FAP PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.53e-19	20	551	19	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|P46371|YTH2_RHOER	9.95e-19	37	547	8	485	Uncharacterized GMC-type oxidoreductase in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=3 SV=1
sp|Q8NE62|CHDH_HUMAN	3.33e-18	5	551	2	571	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000571	0.999401	CS pos: 22-23. Pr: 0.9570

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1891375-t33_1-p1.