CAZyme Information: ASPACDRAFT_1886980-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1886980-t33_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569		62935.89	5.3447

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878974:446912-448728(+)

Full Sequence      

MNQTWEFVVVGGGPAGCALASTLARSAKHPRVLLLEAGPRNEDLSLRVDGQRWSTFLQGD
LNWGYTTTPQEHCNGRQIDYSRGKVLGGSSAINFGVYTVGARDDYDQWAALVGDEAFGWE
RMRSRFCGLETFDGAIVDPKNVKYASPQALNHGSTGGLRVGFAREWEQDLPLMLDVFEQA
GLARNPDHNSGDPIGMGLIINSSHNGRRVTATDLLEGVPDNLTIITEAPVQRVILEGTKA
VGVESNGRQYLASREVILTAGSLDTPRILMHSGLGPADQLQQFQIPVRKDIPALGKGLRD
HFFAPLCFKRDPATNDRNAFFGDQAAMKTAMAQWNKDGTGPWARHSCQIAAGWLKSDRLV
RTAEFQALPSDVQDFLQRKTVPHYEFLTHFPLHLVAPEWPPDYSYICMLVFLMNEQSSGE
VRLQSSDPNVPLLFDPKFLSHDFDRRACIEIFRDALEVTRHPSFQKDVVETVIAPASDSD
ADILEHWKDTLGSSWHMTGTAKMGRSGEADAVVDSHFRMLGVENLRIADMSVVPVLTNNH
TQATAYVTGATCGEVLVEEYDLDREVARL

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_1886980-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	557	1.5e-143	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.30e-87	1	559	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.91e-80	1	544	2	519	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.70e-35	416	552	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.34e-35	2	549	53	569	Protein HOTHEAD
366272	GMC_oxred_N	7.27e-24	73	301	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46531.1|AA3_2	0.0	2	569	5	572
BCR99292.1|AA3_2	0.0	2	569	5	572
BCS11595.1|AA3_2	0.0	2	569	5	572
EAA62931.1|AA3_2	1.76e-271	2	569	4	575
UPL00845.1|AA3_2	2.96e-265	2	562	3	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	8.36e-62	5	561	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	5.19e-54	5	549	2	554	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.28e-54	5	549	3	555	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6YS1_AAA	4.37e-52	2	543	5	547	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	1.15e-51	2	543	5	547	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	1.87e-64	1	543	1	514	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q3L245|PDH1_LEUMG	4.30e-61	5	561	41	602	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	2.57e-60	2	546	48	614	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	6.84e-60	2	546	49	614	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	6.03e-58	5	562	2	533	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999968	0.000056

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1886980-t33_1-p1.