CAZyme Information: ASPACDRAFT_1885235-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1885235-t33_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	KV878971|CGC3	38793.44	5.6289

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878971:1324058-1325304(-)

Full Sequence      

MLALWQCLALAAIPTVSAIPSGSSQKKAFDWDSTKYLLVFPWAKSFGDSYTYVQGTHGHQ
NYSFIGDLQNFAYDAQTLLTDKIVQNQTATAEGGPNWVEYLTGCGVEDGIISPLDCERQL
WDFAFAGSDISVAYTPLHHNYTVSLVNQVTQFTIYGQPVLSRHISAPQTLVAIWIGINDI
GDSAKYAVDFPAFYDTLITTLFASVQEIYAQGYRSYLFVNLPPLDRTPGNQALSQPYPNA
TQVAWYNDALARHAAAFHRNHTDTAVHLFDAHRTLSEIMDHPAAYGIVNTTNFCPGYDQP
DIAWNYRAYGCPTPLEEYFWFNSGHLTSHVHRILAGVLEGKLREWSK

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_1885235-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	45	336	3.6e-85	0.9775280898876404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	2.23e-64	46	335	5	264	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	5.00e-19	123	338	80	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	1.38e-08	41	335	17	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	5.63e-08	166	335	101	274	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	0.002	81	272	6	190	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS08972.1|CE0	3.06e-185	5	336	5	330
BCR96460.1|CE0	3.06e-185	5	336	5	330
QRD91661.1|CE0	2.13e-168	18	343	18	336
UDD64353.1|CE0	2.13e-168	18	343	18	336
QMW35262.1|CE0	2.55e-168	18	343	23	341

PDB Hits     

ASPACDRAFT_1885235-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2FKR1|AES1_THETO	3.43e-18	33	335	30	290	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|G2QJ27|AES1_MYCTT	1.20e-17	90	335	68	290	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999777	CS pos: 18-19. Pr: 0.9760

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1885235-t33_1-p1.