CAZyme Information: ASPACDRAFT_1883105-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1883105-t33_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771		85650.34	5.9307

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878986:922622-925009(+)

Full Sequence      

MPRSHLGALAVLATSLSLGQARSIWSLGNGFELAWQPDLHQVSFLQNNQTVLSTVPGQSF
LSASAGKDQIVDSSGNFKITNVDQGRCQGQNVTDVARSTRPDSLGHGVTIQGYLLNCSNQ
DIAYSSSFWVPANLSDRVAFEVNVDAGRDASAPMERLYLTFGSHPSEDFYGLGAQASFAS
MKNQTIPIFSREQGVGRGDQPYTAIEDSQSFFRGGDRYTTYTAIPQYISSDGHVFYLLED
DSAYATFDFRDPDSVTVRYDALTVHGHFMKADNMLEGITMLTEYTGRMPSLPEWVDQGAV
LGIQGGQDKVNRIVEEGLQHDCPVAAVWLQDWSGTHLQSAPYGHINISRLWWNWEPDTDL
YPTWSEFVQDLRSEHNVRTLAYVNPFLANVSSKSDGYRRNLFLEATQHHYTVQNTTTNTT
AIISSGKGIDAGILDLTNPTTRQWFAAVLRDQVWSANISGCMWDFGEYTPITSDTRLAHL
PDGEDAFTYHNRYPREWAAFQRAAAASTPLAAEMVTFHRSASMGANRHMNLFWAGDQAIA
WTRNDGVKSAVTIMAHMGVSGYAHSHSDIGGYTTIFEPPQSQNSSGAIPRSPELLGRWGE
LAAVSSAFFRSHEGNVPQVNAQFYSNASTYAYFAYNARMFKALGPYRRRVLRTESEAKGW
PLLRMPVLYHPEDVRARQISYESFFLGSDLYVAPVLDEGRREVEVYLPGGDVRGRSYLHV
WSGVKYRAGQTVTVQAPLGKPAVFVVDGARSAELDVFWEFVRRENGTVLGV

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_1883105-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	268	749	3.3e-69	0.9882903981264637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	0.0	28	754	17	626	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	1.88e-146	286	637	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	7.98e-65	155	749	141	668	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	1.20e-41	282	749	16	440	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	5.13e-27	306	711	16	363	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07610.1|GH31	0.0	1	769	1	766
BCR95040.1|GH31	0.0	1	769	1	766
CAK39259.1|GH31	0.0	1	769	1	766
QMW44330.1|GH31	0.0	4	771	6	770
QMW32300.1|GH31	0.0	4	771	6	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AED_A	1.08e-99	36	744	5	661	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	5.77e-99	36	744	5	661	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
6PNR_A	3.11e-91	154	769	99	669	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5OHY_A	1.13e-88	154	744	97	646	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	5.93e-88	154	744	97	646	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	4.55e-99	36	744	5	661	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|Q69ZQ1|MYORG_MOUSE	1.21e-14	299	717	321	687	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
sp|Q6NSJ0|MYORG_HUMAN	6.30e-14	299	717	322	685	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
sp|B9F676|GLU2A_ORYSJ	1.70e-13	296	729	373	755	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
sp|Q14697|GANAB_HUMAN	5.16e-13	431	765	507	820	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999757	CS pos: 21-22. Pr: 0.9716

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1883105-t33_1-p1.